| UniProt ID | AL14E_HUMAN | |
|---|---|---|
| UniProt AC | Q8N8R7 | |
| Protein Name | ARL14 effector protein | |
| Gene Name | ARL14EP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 260 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Through its interaction with ARL14 and MYO1E, may connect MHC class II-containing cytoplasmic vesicles to the actin network and hence controls the movement of these vesicles along the actin cytoskeleton in dendritic cells.. | |
| Protein Sequence | MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHAG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MMDPCSVG -------CCCCCCEE | 22814378 | ||
| 19 | Sumoylation | RTTNECHKTYYTRHT ECCCCCCCCEECCCC | - | ||
| 19 | Sumoylation | RTTNECHKTYYTRHT ECCCCCCCCEECCCC | - | ||
| 19 | Ubiquitination | RTTNECHKTYYTRHT ECCCCCCCCEECCCC | 29967540 | ||
| 20 | Phosphorylation | TTNECHKTYYTRHTG CCCCCCCCEECCCCC | 29496907 | ||
| 21 | Phosphorylation | TNECHKTYYTRHTGF CCCCCCCEECCCCCC | 29496907 | ||
| 23 | Phosphorylation | ECHKTYYTRHTGFKT CCCCCEECCCCCCCC | 29496907 | ||
| 57 | Ubiquitination | LSGNNTICFHHVKIY ECCCCEEEEEEEEEE | 27667366 | ||
| 64 | Phosphorylation | CFHHVKIYIDRFEDL EEEEEEEEECCHHHH | 23403867 | ||
| 65 | Ubiquitination | FHHVKIYIDRFEDLQ EEEEEEEECCHHHHH | 27667366 | ||
| 73 | Ubiquitination | DRFEDLQKSCCDPFN CCHHHHHHHCCCCCH | 29967540 | ||
| 79 | Ubiquitination | QKSCCDPFNIHKKLA HHHCCCCCHHHHHHH | 27667366 | ||
| 83 | Ubiquitination | CDPFNIHKKLAKKNL CCCCHHHHHHHHCCC | 32015554 | ||
| 84 | Ubiquitination | DPFNIHKKLAKKNLH CCCHHHHHHHHCCCE | - | ||
| 88 | Sumoylation | IHKKLAKKNLHVIDL HHHHHHHCCCEEEEC | - | ||
| 88 | Ubiquitination | IHKKLAKKNLHVIDL HHHHHHHCCCEEEEC | 29967540 | ||
| 88 | Sumoylation | IHKKLAKKNLHVIDL HHHHHHHCCCEEEEC | - | ||
| 102 | Phosphorylation | LDDATFLSAKFGRQL CCCCCEECHHHCCCC | 27282143 | ||
| 104 | Sumoylation | DATFLSAKFGRQLVP CCCEECHHHCCCCCC | - | ||
| 104 | Sumoylation | DATFLSAKFGRQLVP CCCEECHHHCCCCCC | - | ||
| 104 | Ubiquitination | DATFLSAKFGRQLVP CCCEECHHHCCCCCC | 21963094 | ||
| 114 | Sumoylation | RQLVPGWKLCPKCTQ CCCCCCCEECCCCCE | - | ||
| 114 | Sumoylation | RQLVPGWKLCPKCTQ CCCCCCCEECCCCCE | - | ||
| 114 | Ubiquitination | RQLVPGWKLCPKCTQ CCCCCCCEECCCCCE | 22817900 | ||
| 118 | Ubiquitination | PGWKLCPKCTQIING CCCEECCCCCEECCC | 21963094 | ||
| 141 | Phosphorylation | RQKRKPESDGRTAKA HHHCCCCCCCHHHHH | 29457462 | ||
| 145 | Ubiquitination | KPESDGRTAKALRSL CCCCCCHHHHHHHHC | 21963094 | ||
| 147 | Acetylation | ESDGRTAKALRSLQF CCCCHHHHHHHHCCC | 7338411 | ||
| 151 | Phosphorylation | RTAKALRSLQFTNPG HHHHHHHHCCCCCCC | 21406692 | ||
| 155 | Phosphorylation | ALRSLQFTNPGRQTE HHHHCCCCCCCCCCC | 21406692 | ||
| 169 | Acetylation | EFAPETGKREKRRLT CCCCCCCHHHHHHHC | 25953088 | ||
| 169 | Sumoylation | EFAPETGKREKRRLT CCCCCCCHHHHHHHC | - | ||
| 169 | Ubiquitination | EFAPETGKREKRRLT CCCCCCCHHHHHHHC | 32015554 | ||
| 169 | Sumoylation | EFAPETGKREKRRLT CCCCCCCHHHHHHHC | - | ||
| 177 | Sumoylation | REKRRLTKNATAGSD HHHHHHCCCCCCCCC | 28112733 | ||
| 177 | Ubiquitination | REKRRLTKNATAGSD HHHHHHCCCCCCCCC | 27667366 | ||
| 177 | Sumoylation | REKRRLTKNATAGSD HHHHHHCCCCCCCCC | - | ||
| 180 | Phosphorylation | RRLTKNATAGSDRQV HHHCCCCCCCCCCCE | 28450419 | ||
| 183 | Phosphorylation | TKNATAGSDRQVIPA CCCCCCCCCCCEECC | 28112733 | ||
| 191 | Ubiquitination | DRQVIPAKSKVYDSQ CCCEECCCCCEECCC | 27667366 | ||
| 191 | Sumoylation | DRQVIPAKSKVYDSQ CCCEECCCCCEECCC | - | ||
| 191 | Sumoylation | DRQVIPAKSKVYDSQ CCCEECCCCCEECCC | - | ||
| 192 | Phosphorylation | RQVIPAKSKVYDSQG CCEECCCCCEECCCC | 25332170 | ||
| 193 | Ubiquitination | QVIPAKSKVYDSQGL CEECCCCCEECCCCE | - | ||
| 240 | Ubiquitination | AECRCDRKWLYEQIE CEECCCCCHHEEEEE | 29967540 | ||
| 240 | Sumoylation | AECRCDRKWLYEQIE CEECCCCCHHEEEEE | - | ||
| 240 | Sumoylation | AECRCDRKWLYEQIE CEECCCCCHHEEEEE | - | ||
| 243 | Phosphorylation | RCDRKWLYEQIEIEG CCCCCHHEEEEEEEC | 27642862 | ||
| 257 | Ubiquitination | GGEIIHNKHAG---- CCEEEECCCCC---- | 21963094 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AL14E_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AL14E_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AL14E_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PKHF2_HUMAN | PLEKHF2 | physical | 21516116 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
