UniProt ID | NR4A1_HUMAN | |
---|---|---|
UniProt AC | P22736 | |
Protein Name | Nuclear receptor subfamily 4 group A member 1 | |
Gene Name | NR4A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 598 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation.. | |
Protein Sequence | MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MPCIQAQYGTPAPSP CCCEECCCCCCCCCC | 26.44 | 26270265 | |
10 | Phosphorylation | CIQAQYGTPAPSPGP CEECCCCCCCCCCCC | 16.02 | 25159151 | |
14 | Phosphorylation | QYGTPAPSPGPRDHL CCCCCCCCCCCCCCC | 44.59 | 25159151 | |
23 | Phosphorylation | GPRDHLASDPLTPEF CCCCCCCCCCCCHHH | 46.23 | 25159151 | |
27 | Phosphorylation | HLASDPLTPEFIKPT CCCCCCCCHHHHCCC | 26.59 | 25159151 | |
48 | Phosphorylation | EAAPAAPTALPSFST CCCCCCCCCCCCCCH | 35.78 | - | |
52 | Phosphorylation | AAPTALPSFSTFMDG CCCCCCCCCCHHHCC | 32.45 | - | |
54 | Phosphorylation | PTALPSFSTFMDGYT CCCCCCCCHHHCCCC | 25.69 | - | |
55 | Phosphorylation | TALPSFSTFMDGYTG CCCCCCCHHHCCCCC | 22.44 | - | |
60 | Phosphorylation | FSTFMDGYTGEFDTF CCHHHCCCCCEEEEE | 13.80 | - | |
61 | Phosphorylation | STFMDGYTGEFDTFL CHHHCCCCCEEEEEE | 35.45 | - | |
95 | Phosphorylation | TSSSSATSPASASFK CCCCCCCCCCEECEE | 20.41 | 22002310 | |
100 | Phosphorylation | ATSPASASFKFEDFQ CCCCCEECEEECCEE | 26.86 | 24719451 | |
102 | Sumoylation | SPASASFKFEDFQVY CCCEECEEECCEEEE | 45.40 | - | |
140 | Phosphorylation | GSPCSAPSPSTPSFQ CCCCCCCCCCCCCCC | 31.06 | 22002310 | |
143 | Phosphorylation | CSAPSPSTPSFQPPQ CCCCCCCCCCCCCCC | 26.74 | 22234305 | |
152 | Phosphorylation | SFQPPQLSPWDGSFG CCCCCCCCCCCCCCC | 20.78 | - | |
174 | Phosphorylation | YEGLRAWTEQLPKAS HHHHHHHHHHCCCCC | 16.93 | 28555341 | |
191 | Phosphorylation | PQPPAFFSFSPPTGP CCCCCEEECCCCCCC | 20.54 | 28102081 | |
193 | Phosphorylation | PPAFFSFSPPTGPSP CCCEEECCCCCCCCC | 28.86 | 25159151 | |
196 | Phosphorylation | FFSFSPPTGPSPSLA EEECCCCCCCCCCHH | 66.17 | 21712546 | |
199 | Phosphorylation | FSPPTGPSPSLAQSP CCCCCCCCCCHHCCC | 28.59 | 25850435 | |
201 | Phosphorylation | PPTGPSPSLAQSPLK CCCCCCCCHHCCCCC | 40.45 | 18691976 | |
205 | Phosphorylation | PSPSLAQSPLKLFPS CCCCHHCCCCCCCCC | 26.96 | 25850435 | |
214 | Phosphorylation | LKLFPSQATHQLGEG CCCCCCCCCCCCCCC | 16.04 | 24719451 | |
218 | Phosphorylation | PSQATHQLGEGESYS CCCCCCCCCCCCCCC | 5.38 | 27251275 | |
236 | Phosphorylation | AFPGLAPTSPHLEGS CCCCCCCCCCCCCCC | 49.65 | 26074081 | |
237 | Phosphorylation | FPGLAPTSPHLEGSG CCCCCCCCCCCCCCC | 14.84 | 26074081 | |
243 | Phosphorylation | TSPHLEGSGILDTPV CCCCCCCCCCCCCCC | 17.18 | 28348404 | |
257 | Phosphorylation | VTSTKARSGAPGGSE CCCCCCCCCCCCCCC | 44.13 | - | |
263 | Phosphorylation | RSGAPGGSEGRCAVC CCCCCCCCCCCEEEC | 42.67 | 21712546 | |
279 | Phosphorylation | DNASCQHYGVRTCEG CCCCCCCCCCCCCCC | 7.46 | - | |
283 | Phosphorylation | CQHYGVRTCEGCKGF CCCCCCCCCCCCCCH | 16.71 | - | |
288 | Acetylation | VRTCEGCKGFFKRTV CCCCCCCCCHHHHHH | 70.39 | 26051181 | |
300 | Sumoylation | RTVQKNAKYICLANK HHHHHCCCEEEECCC | 44.54 | - | |
300 | Sumoylation | RTVQKNAKYICLANK HHHHHCCCEEEECCC | 44.54 | - | |
300 | Ubiquitination | RTVQKNAKYICLANK HHHHHCCCEEEECCC | 44.54 | - | |
300 | Acetylation | RTVQKNAKYICLANK HHHHHCCCEEEECCC | 44.54 | 26051181 | |
307 | Ubiquitination | KYICLANKDCPVDKR CEEEECCCCCCCCHH | 55.91 | - | |
307 | Acetylation | KYICLANKDCPVDKR CEEEECCCCCCCCHH | 55.91 | 26051181 | |
339 | Phosphorylation | MVKEVVRTDSLKGRR CEEEEEECCCCCCCC | 20.52 | 28102081 | |
341 | Phosphorylation | KEVVRTDSLKGRRGR EEEEECCCCCCCCCC | 31.22 | 28355574 | |
351 | Phosphorylation | GRRGRLPSKPKQPPD CCCCCCCCCCCCCCC | 67.21 | 22322096 | |
360 | Phosphorylation | PKQPPDASPANLLTS CCCCCCCCHHHHHHH | 31.74 | 22322096 | |
364 | Phosphorylation | PDASPANLLTSLVRA CCCCHHHHHHHHHHH | 6.32 | 24719451 | |
381 | Sumoylation | DSGPSTAKLDYSKFQ HCCCCCCCCCHHHHH | 41.81 | - | |
381 | Ubiquitination | DSGPSTAKLDYSKFQ HCCCCCCCCCHHHHH | 41.81 | 21906983 | |
381 | Sumoylation | DSGPSTAKLDYSKFQ HCCCCCCCCCHHHHH | 41.81 | - | |
386 | Ubiquitination | TAKLDYSKFQELVLP CCCCCHHHHHHHHCC | 44.85 | - | |
431 | Phosphorylation | IPGFAELSPADQDLL CCCCCCCCHHHHHHH | 15.00 | 22002310 | |
558 | Ubiquitination | CLSRLLGKLPELRTL HHHHHHCCCHHHHHH | 61.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
95 | S | Phosphorylation | Kinase | MAPK8 | P45983 | GPS |
95 | S | Phosphorylation | Kinase | JNK-SUBFAMILY | - | GPS |
152 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
341 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
351 | S | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
351 | S | Phosphorylation | Kinase | AKT1 | P31750 | PSP |
351 | S | Phosphorylation | Kinase | AKT-FAMILY | - | GPS |
351 | S | Phosphorylation | Kinase | PKB_GROUP | - | PhosphoELM |
431 | S | Phosphorylation | Kinase | MAPK1 | P28482 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
351 | S | Phosphorylation |
| 17360704 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NR4A1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...