CXCL7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CXCL7_HUMAN
• UniProt AC: P02775
• Protein Name: Platelet basic protein
• Gene Name: PPBP
• Organism: Homo sapiens (Human).
• Sequence Length: 128
• Subcellular Localization: Secreted.
• Protein Description: LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation..
• Protein Sequence: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	LAKGKEESLDSDLYA HHCCCHHHCCHHHHH	38.27	26657352
55	Phosphorylation	GKEESLDSDLYAELR CCHHHCCHHHHHHHH	34.50	29691806
58	Phosphorylation	ESLDSDLYAELRCMC HHCCHHHHHHHHHHH	11.74	28060719
68	Phosphorylation	LRCMCIKTTSGIHPK HHHHHHCCCCCCCCC	13.29	22210691
69	Phosphorylation	RCMCIKTTSGIHPKN HHHHHCCCCCCCCCC	21.69	28060719
70	Phosphorylation	CMCIKTTSGIHPKNI HHHHCCCCCCCCCCC	40.77	28060719
79	Phosphorylation	IHPKNIQSLEVIGKG CCCCCCCEEEEECCC	23.77	28270605
87	Phosphorylation	LEVIGKGTHCNQVEV EEEECCCCCCCEEEE	27.09	28060719
126	Phosphorylation	KKLAGDESAD----- HHHCCCCCCC-----	42.34	27535140

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CXCL7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CXCL7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CXCL7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CXCL7_HUMAN	PPBP	physical	8051099

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.