UniProt ID | KAIN_HUMAN | |
---|---|---|
UniProt AC | P29622 | |
Protein Name | Kallistatin | |
Gene Name | SERPINA4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 427 | |
Subcellular Localization | Secreted. | |
Protein Description | Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.. | |
Protein Sequence | MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | HVEHDGESCSNSSHQ EECCCCCCCCCCCCH | 28.51 | 27130503 | |
32 | Phosphorylation | EHDGESCSNSSHQQI CCCCCCCCCCCCHHH | 49.37 | 27130503 | |
33 | N-linked_Glycosylation | HDGESCSNSSHQQIL CCCCCCCCCCCHHHH | 52.43 | UniProtKB CARBOHYD | |
34 | Phosphorylation | DGESCSNSSHQQILE CCCCCCCCCCHHHHH | 16.95 | 27130503 | |
35 | Phosphorylation | GESCSNSSHQQILET CCCCCCCCCHHHHHC | 29.57 | 27130503 | |
63 | Phosphorylation | ADFAFRFYYLIASET CCEEEEEHHHHHCCC | 7.97 | - | |
64 | Phosphorylation | DFAFRFYYLIASETP CEEEEEHHHHHCCCC | 6.74 | - | |
68 | Phosphorylation | RFYYLIASETPGKNI EEHHHHHCCCCCCCC | 34.70 | - | |
108 | N-linked_Glycosylation | ILEGLGFNLTELSES HHHHCCCCCCCCCHH | 44.23 | 16335952 | |
145 | N-linked_Glycosylation | RVGSALFLSHNLKFL CCCHHHHHHHCHHHH | 5.46 | 16335952 | |
145 | N-linked_Glycosylation | RVGSALFLSHNLKFL CCCHHHHHHHCHHHH | 5.46 | 16335952 | |
157 | N-linked_Glycosylation | KFLAKFLNDTMAVYE HHHHHHHHHHHHHHH | 45.93 | 12754519 | |
194 | N-linked_Glycosylation | KKETRGKIVDLVSEL CHHHHCCHHHHHHHH | 3.03 | 12754519 | |
194 | N-linked_Glycosylation | KKETRGKIVDLVSEL CHHHHCCHHHHHHHH | 3.03 | 12754519 | |
225 | Phosphorylation | LWEKPFISSRTTPKD HHCCCCCCCCCCCCC | 17.72 | 29083192 | |
226 | Phosphorylation | WEKPFISSRTTPKDF HCCCCCCCCCCCCCE | 28.91 | 29083192 | |
228 | Phosphorylation | KPFISSRTTPKDFYV CCCCCCCCCCCCEEE | 49.77 | 29083192 | |
229 | Phosphorylation | PFISSRTTPKDFYVD CCCCCCCCCCCEEEC | 27.51 | 29083192 | |
238 | N-linked_Glycosylation | KDFYVDENTTVRVPM CCEEECCCCEEEEEE | 36.26 | 19139490 | |
275 | N-linked_Glycosylation | MDYKGDATVFFILPN EEECCCEEEEEECCC | 23.68 | 16335952 | |
275 | N-linked_Glycosylation | MDYKGDATVFFILPN EEECCCEEEEEECCC | 23.68 | 16335952 | |
326 | Phosphorylation | PKFSISGSYVLDQIL CCCEEECHHHHHHHH | 12.79 | - | |
343 | Phosphorylation | LGFTDLFSKWADLSG CCCHHHHHHHHCCCC | 34.29 | 24719451 | |
360 | Phosphorylation | KQQKLEASKSFHKAT HHHHHHHCHHHHHHE | 21.32 | 26437602 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAIN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAIN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAIN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FKB14_HUMAN | FKBP14 | physical | 26186194 | |
FDFT_HUMAN | FDFT1 | physical | 26186194 | |
FKB14_HUMAN | FKBP14 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-108; ASN-157 AND ASN-238,AND MASS SPECTROMETRY. | |
"Identification and quantification of N-linked glycoproteins usinghydrazide chemistry, stable isotope labeling and mass spectrometry."; Zhang H., Li X.-J., Martin D.B., Aebersold R.; Nat. Biotechnol. 21:660-666(2003). Cited for: GLYCOSYLATION AT ASN-157. |