UniProt ID | FKB14_HUMAN | |
---|---|---|
UniProt AC | Q9NWM8 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP14 | |
Gene Name | FKBP14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | PPIase which accelerates the folding of proteins during protein synthesis. Has a preference for substrates containing 4-hydroxylproline modifications, including type III collagen. May also target type VI and type X collagens.. | |
Protein Sequence | MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
93 | Acetylation | KGWDQGLKGMCVGEK CCCCCCCCCEECCCC | 51.96 | 30588791 | |
100 | Acetylation | KGMCVGEKRKLIIPP CCEECCCCEEEEECC | 49.24 | 30588797 | |
161 | Ubiquitination | KLSKDEVKAYLKKEF CCCHHHHHHHHHHHH | 29.30 | - | |
176 | N-linked_Glycosylation | EKHGAVVNESHHDAL HHHCCCCCCCHHHHH | 38.15 | UniProtKB CARBOHYD | |
207 | "N6,N6-dimethyllysine" | SAREFTYKHDEL--- EEEEEEECCCCC--- | 41.33 | - | |
207 | Methylation | SAREFTYKHDEL--- EEEEEEECCCCC--- | 41.33 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HS74L_HUMAN | HSPA4L | physical | 26344197 | |
PLSL_HUMAN | LCP1 | physical | 26344197 | |
PLSI_HUMAN | PLS1 | physical | 26344197 | |
IPYR2_HUMAN | PPA2 | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...