UniProt ID | IL32_HUMAN | |
---|---|---|
UniProt AC | P24001 | |
Protein Name | Interleukin-32 | |
Gene Name | IL32 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization | Secreted . | |
Protein Description | Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.. | |
Protein Sequence | MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Ubiquitination | KVLSDDMKKLKARMV CCCCHHHHHHHHHHH | 63.05 | 22505724 | |
12 | Ubiquitination | KVLSDDMKKLKARMV CCCCHHHHHHHHHHH | 63.05 | - | |
13 | Ubiquitination | VLSDDMKKLKARMVM CCCHHHHHHHHHHHH | 48.89 | - | |
13 | Ubiquitination | VLSDDMKKLKARMVM CCCHHHHHHHHHHHH | 48.89 | 22505724 | |
18 | Ubiquitination | MKKLKARMVMLLPTS HHHHHHHHHHHCCCC | 2.19 | 29901268 | |
28 (in isoform 1) | Ubiquitination | - | 26.29 | 20972266 | |
28 (in isoform 2) | Ubiquitination | - | 26.29 | - | |
28 | Ubiquitination | LLPTSAQGLGAWVSA HCCCCCCCCCHHHHC | 26.29 | 23000965 | |
35 | Ubiquitination | GLGAWVSACDTEDTV CCCHHHHCCCCCCCC | 5.89 | - | |
50 | Phosphorylation | GHLGPWRDKDPALWC CCCCCCCCCCHHHHH | 56.70 | - | |
51 | Ubiquitination | HLGPWRDKDPALWCQ CCCCCCCCCHHHHHH | 57.97 | - | |
55 | Ubiquitination | WRDKDPALWCQLCLS CCCCCHHHHHHHHHH | 5.98 | 23503661 | |
66 | Ubiquitination | LCLSSQHQAIERFYD HHHHCHHHHHHHHHH | 36.08 | 23503661 | |
67 | Ubiquitination | CLSSQHQAIERFYDK HHHCHHHHHHHHHHH | 11.95 | - | |
74 | Ubiquitination | AIERFYDKMQNAESG HHHHHHHHHHHCCCC | 30.89 | 23000965 | |
75 | Ubiquitination | IERFYDKMQNAESGR HHHHHHHHHHCCCCC | 3.20 | 23503661 | |
75 (in isoform 2) | Ubiquitination | - | 3.20 | - | |
87 | Phosphorylation | SGRGQVMSSLAELED CCCHHHHHHHHHHHH | 24.28 | 28122231 | |
88 | Phosphorylation | GRGQVMSSLAELEDD CCHHHHHHHHHHHHH | 17.32 | 28122231 | |
97 | Ubiquitination | AELEDDFKEGYLETV HHHHHHHHHCHHHHH | 58.17 | - | |
100 | Phosphorylation | EDDFKEGYLETVAAY HHHHHHCHHHHHHHH | 11.49 | 27642862 | |
103 | Phosphorylation | FKEGYLETVAAYYEE HHHCHHHHHHHHHHH | 16.92 | 28796482 | |
107 | Phosphorylation | YLETVAAYYEEQHPE HHHHHHHHHHHHCCC | 11.15 | 28796482 | |
108 | Phosphorylation | LETVAAYYEEQHPEL HHHHHHHHHHHCCCC | 14.30 | 28796482 | |
116 | Phosphorylation | EEQHPELTPLLEKER HHHCCCCHHHHHHHH | 15.38 | 28796482 | |
121 | Ubiquitination | ELTPLLEKERDGLRC CCHHHHHHHHCCCCC | 59.00 | 23503661 | |
133 | Phosphorylation | LRCRGNRSPVPDVED CCCCCCCCCCCCCCC | 33.96 | 23401153 | |
143 | Phosphorylation | PDVEDPATEEPGESF CCCCCCCCCCCCHHH | 46.39 | 28111955 | |
149 | Phosphorylation | ATEEPGESFCDKVMR CCCCCCHHHHHHHHH | 36.77 | 28111955 | |
153 | Ubiquitination | PGESFCDKVMRWFQA CCHHHHHHHHHHHHH | 38.83 | - | |
219 | Ubiquitination | YGAPRGDKEELTPQK HCCCCCCHHHCCCCC | 56.78 | - | |
223 | Phosphorylation | RGDKEELTPQKCSEP CCCHHHCCCCCCCCC | 27.27 | 24719451 | |
226 | Ubiquitination | KEELTPQKCSEPQSS HHHCCCCCCCCCCCC | 40.71 | - | |
234 | Ubiquitination | CSEPQSSK------- CCCCCCCC------- | 70.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL32_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL32_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL32_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IL32_HUMAN | IL32 | physical | 25178676 | |
ZBT16_HUMAN | ZBTB16 | physical | 25178676 | |
FOG2_HUMAN | ZFPM2 | physical | 25178676 | |
C1QB_HUMAN | C1QB | physical | 25178676 | |
NQO2_HUMAN | NQO2 | physical | 25178676 | |
IMA6_HUMAN | KPNA5 | physical | 25178676 | |
HSP7C_HUMAN | HSPA8 | physical | 25178676 | |
STPAP_HUMAN | TUT1 | physical | 25178676 | |
NECD_HUMAN | NDN | physical | 25178676 | |
RU17_HUMAN | SNRNP70 | physical | 25178676 | |
RL4_HUMAN | RPL4 | physical | 25178676 | |
KPCD_HUMAN | PRKCD | physical | 25178676 | |
KPCE_HUMAN | PRKCE | physical | 25178676 | |
BCL6_HUMAN | BCL6 | physical | 25245533 | |
VHL_HUMAN | VHL | physical | 29050245 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...