| UniProt ID | IMA6_HUMAN | |
|---|---|---|
| UniProt AC | O15131 | |
| Protein Name | Importin subunit alpha-6 | |
| Gene Name | KPNA5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 536 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates nuclear import of STAT1 homodimers and STAT1/STAT2 heterodimers by recognizing non-classical NLSs of STAT1 and STAT2 through ARM repeats 8-9. Recognizes influenza A virus nucleoprotein through ARM repeat 7-9 In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.. | |
| Protein Sequence | MASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASPGKDNY ------CCCCCCCCC | - | ||
| 3 | Phosphorylation | -----MASPGKDNYR -----CCCCCCCCCC | 23401153 | ||
| 6 | Phosphorylation | --MASPGKDNYRMKS --CCCCCCCCCCCHH | 24719451 | ||
| 6 | Ubiquitination | --MASPGKDNYRMKS --CCCCCCCCCCCHH | 24816145 | ||
| 9 | Phosphorylation | ASPGKDNYRMKSYKN CCCCCCCCCCHHHHC | 22673903 | ||
| 9 | Ubiquitination | ASPGKDNYRMKSYKN CCCCCCCCCCHHHHC | 24816145 | ||
| 14 | Phosphorylation | DNYRMKSYKNKALNP CCCCCHHHHCCCCCH | - | ||
| 26 | Phosphorylation | LNPQEMRRRREEEGI CCHHHHHHHHHHHHH | 33259812 | ||
| 29 | Ubiquitination | QEMRRRREEEGIQLR HHHHHHHHHHHHHHH | 24816145 | ||
| 32 | Ubiquitination | RRRREEEGIQLRKQK HHHHHHHHHHHHHHH | 27667366 | ||
| 37 | Ubiquitination | EEGIQLRKQKREEQL HHHHHHHHHHHHHHH | 27667366 | ||
| 46 | Ubiquitination | KREEQLFKRRNVYLP HHHHHHHHHCCCCCC | 21890473 | ||
| 49 | Ubiquitination | EQLFKRRNVYLPRND HHHHHHCCCCCCCCC | 21890473 | ||
| 69 | Ubiquitination | SPIQDPDISSTVPIP CCCCCCCCCCCCCCC | 21890473 | ||
| 110 | Methylation | KFRKLLSKEPNPPID HHHHHHCCCCCCCHH | 23644510 | ||
| 110 | Ubiquitination | KFRKLLSKEPNPPID HHHHHHCCCCCCCHH | - | ||
| 110 | "N6,N6-dimethyllysine" | KFRKLLSKEPNPPID HHHHHHCCCCCCCHH | - | ||
| 113 | Methylation | KLLSKEPNPPIDQVI HHHCCCCCCCHHHHH | - | ||
| 113 | Ubiquitination | KLLSKEPNPPIDQVI HHHCCCCCCCHHHHH | - | ||
| 122 | Ubiquitination | PIDQVIQKPGVVQRF CHHHHHCCHHHHHHH | - | ||
| 125 | Ubiquitination | QVIQKPGVVQRFVKF HHHCCHHHHHHHHHH | 29967540 | ||
| 131 | Ubiquitination | GVVQRFVKFLERNEN HHHHHHHHHHHHCCC | 21890473 | ||
| 134 | Ubiquitination | QRFVKFLERNENCTL HHHHHHHHHCCCCEE | 21890473 | ||
| 154 | Phosphorylation | WALTNIASGTFLHTK HHHHHHCCCCCEEEE | - | ||
| 154 | Ubiquitination | WALTNIASGTFLHTK HHHHHHCCCCCEEEE | 21890473 | ||
| 187 | Ubiquitination | HEDVQEQAVWALGNI CHHHHHHHHHHHHHH | 22817900 | ||
| 192 | Ubiquitination | EQAVWALGNIAGDNA HHHHHHHHHHCCCCH | 22817900 | ||
| 219 | Phosphorylation | PPLLELLTNSNRLTT HHHHHHHHCCCCCCC | - | ||
| 235 | Phosphorylation | RNAVWALSNLCRGKN HHHHHHHHHHHCCCC | 21712546 | ||
| 238 | Phosphorylation | VWALSNLCRGKNPPP HHHHHHHHCCCCCCC | - | ||
| 241 | Ubiquitination | LSNLCRGKNPPPNFS HHHHHCCCCCCCCHH | 27667366 | ||
| 244 | Ubiquitination | LCRGKNPPPNFSKVS HHCCCCCCCCHHHHH | 27667366 | ||
| 264 | Ubiquitination | LSRLLFSSDPDVLAD HHHHHHCCCHHHHHH | 27667366 | ||
| 293 | Phosphorylation | KIQAVIDSGVCRRLV HHHHHHHHHHHHHHH | 32142685 | ||
| 296 | Phosphorylation | AVIDSGVCRRLVELL HHHHHHHHHHHHHHH | 32142685 | ||
| 308 | Phosphorylation | ELLMHNDYKVVSPAL HHHHCCCHHHHCHHH | - | ||
| 309 | Ubiquitination | LLMHNDYKVVSPALR HHHCCCHHHHCHHHH | - | ||
| 312 | Ubiquitination | HNDYKVVSPALRAVG CCCHHHHCHHHHHHC | - | ||
| 316 | Phosphorylation | KVVSPALRAVGNIVT HHHCHHHHHHCCEEC | 32142685 | ||
| 396 | Ubiquitination | KAEFRTRKEAAWAIT HCCCCCHHHHHHHHH | 22817900 | ||
| 399 | Ubiquitination | FRTRKEAAWAITNAT CCCHHHHHHHHHCCC | 21906983 | ||
| 416 | Phosphorylation | GTPEQIRYLVALGCI CCHHHHHHHHHHCCH | 21406692 | ||
| 419 | Ubiquitination | EQIRYLVALGCIKPL HHHHHHHHHCCHHHH | 22817900 | ||
| 419 | Phosphorylation | EQIRYLVALGCIKPL HHHHHHHHHCCHHHH | - | ||
| 474 | Phosphorylation | CALIEEAYGLDKIEF HHHHHHHHCCCHHHH | 25884760 | ||
| 477 | Phosphorylation | IEEAYGLDKIEFLQS HHHHHCCCHHHHHHC | - | ||
| 491 | Phosphorylation | SHENQEIYQKAFDLI CCCCHHHHHHHHHHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMA6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMA6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMA6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IMB1_HUMAN | KPNB1 | physical | 22939629 | |
| AN32B_HUMAN | ANP32B | physical | 25416956 | |
| NUP50_HUMAN | NUP50 | physical | 25416956 | |
| SPOPL_HUMAN | SPOPL | physical | 25416956 | |
| RBBP4_HUMAN | RBBP4 | physical | 26491019 | |
| PHB2_HUMAN | PHB2 | physical | 26052702 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...