SPOPL_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPOPL_HUMAN
• UniProt AC: Q6IQ16
• Protein Name: Speckle-type POZ protein-like
• Gene Name: SPOPL
• Organism: Homo sapiens (Human).
• Sequence Length: 392
• Subcellular Localization: Nucleus.
• Protein Description: Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins, but with relatively low efficiency. Cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes containing homodimeric SPOPL or the heterodimer formed by SPOP and SPOPL are less efficient than ubiquitin ligase complexes containing only SPOP. May function to down-regulate the activity of cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes that contain SPOP..
• Protein Sequence: MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSGPSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLKVPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSREPTPPLPGDM --CCCCCCCCCCCCC	32.55	28348404
80	Phosphorylation	PKGLDDESKDYLSLY CCCCCHHHHHHHHHH	37.51	29083192
83	Phosphorylation	LDDESKDYLSLYLLL CCHHHHHHHHHHHHH	11.26	29083192
85	Phosphorylation	DESKDYLSLYLLLVS HHHHHHHHHHHHHHH	14.56	29083192
87	Phosphorylation	SKDYLSLYLLLVSCP HHHHHHHHHHHHHCC	7.60	29083192
92	Phosphorylation	SLYLLLVSCPKSEVR HHHHHHHHCCHHHHH	25.35	29083192
96	Phosphorylation	LLVSCPKSEVRAKFK HHHHCCHHHHHHHHH	26.85	29083192
105	O-linked_Glycosylation	VRAKFKFSLLNAKRE HHHHHHHHHHHHHHH	32.32	30379171
110	Acetylation	KFSLLNAKREETKAM HHHHHHHHHHHHHHH	60.30	90561
110	Ubiquitination	KFSLLNAKREETKAM HHHHHHHHHHHHHHH	60.30	29967540
163	Ubiquitination	TLFCEVSVVQDSVNI EEEEEEEEEECCEEE	5.60	22817900
204	Ubiquitination	TRFTDCSFFVRGQEF CCCCCCEEEECCCHH	9.14	22817900
215	Ubiquitination	GQEFKAHKSVLAARS CCHHHHCHHHHHHHC	47.31	29967540
236	Phosphorylation	FEHEMEESKKNRVEI HHHHHHHHHHCCCCH	35.31	30576142
260	Phosphorylation	EMMRFIYTGRAPNLD HHHHHHHHCCCCCHH	18.51	24719451
279	Ubiquitination	NLLAAADKYALERLK HHHHHHHHHHHHHHH	27.91	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPOPL_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPOPL_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPOPL_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EPS15_HUMAN	EPS15	physical	27008177

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.