| UniProt ID | C1QB_HUMAN | |
|---|---|---|
| UniProt AC | P02746 | |
| Protein Name | Complement C1q subcomponent subunit B | |
| Gene Name | C1QB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 253 | |
| Subcellular Localization | Secreted. | |
| Protein Description | C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.. | |
| Protein Sequence | MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Pyrrolidone_carboxylic_acid | LIDISQAQLSCTGPP HHCHHHHHHHCCCCC | 26.69 | 708376 | |
| 28 | Pyrrolidone_carboxylic_acid | LIDISQAQLSCTGPP HHCHHHHHHHCCCCC | 26.69 | 708376 | |
| 28 | Pyrrolidone_carboxylic_acid | LIDISQAQLSCTGPP HHCHHHHHHHCCCCC | 26.69 | - | |
| 35 | Hydroxylation | QLSCTGPPAIPGIPG HHHCCCCCCCCCCCC | 44.13 | 486087 | |
| 38 | Hydroxylation | CTGPPAIPGIPGIPG CCCCCCCCCCCCCCC | 36.45 | 486087 | |
| 41 | Hydroxylation | PPAIPGIPGIPGTPG CCCCCCCCCCCCCCC | 40.34 | 486087 | |
| 53 | Hydroxylation | TPGPDGQPGTPGIKG CCCCCCCCCCCCCCC | 54.90 | 486087 | |
| 56 | Hydroxylation | PDGQPGTPGIKGEKG CCCCCCCCCCCCCCC | 48.72 | 486087 | |
| 59 | Hydroxylation | QPGTPGIKGEKGLPG CCCCCCCCCCCCCCC | 67.92 | 486087 | |
| 62 | Hydroxylation | TPGIKGEKGLPGLAG CCCCCCCCCCCCCCC | 74.54 | 486087 | |
| 65 | Hydroxylation | IKGEKGLPGLAGDHG CCCCCCCCCCCCCCC | 44.41 | 486087 | |
| 77 | Hydroxylation | DHGEFGEKGDPGIPG CCCCCCCCCCCCCCC | 69.83 | 486087 | |
| 77 | Trimethylation | DHGEFGEKGDPGIPG CCCCCCCCCCCCCCC | 69.83 | - | |
| 77 | Methylation | DHGEFGEKGDPGIPG CCCCCCCCCCCCCCC | 69.83 | - | |
| 83 | Hydroxylation | EKGDPGIPGNPGKVG CCCCCCCCCCCCCCC | 42.28 | 486087 | |
| 86 | Hydroxylation | DPGIPGNPGKVGPKG CCCCCCCCCCCCCCC | 50.31 | 486087 | |
| 88 | Trimethylation | GIPGNPGKVGPKGPM CCCCCCCCCCCCCCC | 45.32 | - | |
| 88 | Methylation | GIPGNPGKVGPKGPM CCCCCCCCCCCCCCC | 45.32 | - | |
| 92 | Methylation | NPGKVGPKGPMGPKG CCCCCCCCCCCCCCC | 70.49 | - | |
| 92 | Trimethylation | NPGKVGPKGPMGPKG CCCCCCCCCCCCCCC | 70.49 | - | |
| 92 | Hydroxylation | NPGKVGPKGPMGPKG CCCCCCCCCCCCCCC | 70.49 | 486087 | |
| 98 | Hydroxylation | PKGPMGPKGGPGAPG CCCCCCCCCCCCCCC | 71.43 | 486087 | |
| 101 | Hydroxylation | PMGPKGGPGAPGAPG CCCCCCCCCCCCCCC | 44.43 | 486087 | |
| 104 | Hydroxylation | PKGGPGAPGAPGPKG CCCCCCCCCCCCCCC | 45.45 | 486087 | |
| 107 | Hydroxylation | GPGAPGAPGPKGESG CCCCCCCCCCCCCCC | 66.58 | 486087 | |
| 110 | Hydroxylation | APGAPGPKGESGDYK CCCCCCCCCCCCCCH | 79.72 | 486087 | |
| 125 | Phosphorylation | ATQKIAFSATRTINV HCEEEEEEEECEECC | 21.51 | - | |
| 127 | Phosphorylation | QKIAFSATRTINVPL EEEEEEEECEECCCC | 27.44 | - | |
| 129 | Phosphorylation | IAFSATRTINVPLRR EEEEEECEECCCCCC | 16.73 | - | |
| 168 | Phosphorylation | TCKVPGLYYFTYHAS EEECCEEEEEEEEEC | 11.49 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C1QB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C1QB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C1QB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TNR27_HUMAN | EDA2R | physical | 21988832 | |
| TF65_HUMAN | RELA | physical | 21988832 | |
| AT12A_HUMAN | ATP12A | physical | 26186194 | |
| MAP2_HUMAN | METAP2 | physical | 26186194 | |
| GT252_HUMAN | COLGALT2 | physical | 26186194 | |
| SC65_HUMAN | P3H4 | physical | 26186194 | |
| FINC_HUMAN | FN1 | physical | 26186194 | |
| CO4A2_HUMAN | COL4A2 | physical | 26186194 | |
| UBP30_HUMAN | USP30 | physical | 26186194 | |
| GLPK_HUMAN | GK | physical | 26186194 | |
| CF120_HUMAN | C6orf120 | physical | 26186194 | |
| P3H3_HUMAN | LEPREL2 | physical | 26186194 | |
| VHL_HUMAN | VHL | physical | 26186194 | |
| VHL_HUMAN | VHL | physical | 28514442 | |
| FINC_HUMAN | FN1 | physical | 28514442 | |
| UBP30_HUMAN | USP30 | physical | 28514442 | |
| MAP2_HUMAN | METAP2 | physical | 28514442 | |
| P3H3_HUMAN | LEPREL2 | physical | 28514442 | |
| NOCT_HUMAN | CCRN4L | physical | 28514442 | |
| AT12A_HUMAN | ATP12A | physical | 28514442 | |
| DMWD_HUMAN | DMWD | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 613652 | Complement component C1q deficiency (C1QD) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...