UniProt ID | UBP30_HUMAN | |
---|---|---|
UniProt AC | Q70CQ3 | |
Protein Name | Ubiquitin carboxyl-terminal hydrolase 30 | |
Gene Name | USP30 {ECO:0000312|HGNC:HGNC:20065} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 517 | |
Subcellular Localization | Mitochondrion outer membrane . | |
Protein Description | Deubiquitinating enzyme tethered to the mitochondrial outer membrane that acts as a key inhibitor of mitophagy by counteracting the action of parkin (PRKN): hydrolyzes ubiquitin attached by parkin on target proteins, such as RHOT1/MIRO1 and TOMM20, thereby blocking parkin's ability to drive mitophagy. [PubMed: 18287522] | |
Protein Sequence | MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Methylation | ---MLSSRAEAAMTA ---CCCHHHHHHHHH | 32.83 | 115919617 | |
15 | Methylation | AAMTAADRAIQRFLR HHHHHHHHHHHHHHH | 28.94 | 115919609 | |
19 | Methylation | AADRAIQRFLRTGAA HHHHHHHHHHHHCCH | 26.84 | 115919613 | |
76 | Phosphorylation | GLVNLGNTCFMNSLL CHHHCCCCHHHHHHH | 12.81 | 28258704 | |
81 | Phosphorylation | GNTCFMNSLLQGLSA CCCHHHHHHHHHHHH | 20.76 | 28258704 | |
191 | Phosphorylation | THLFDVHSLEQQSEI EEEEECCCHHHCCCC | 33.19 | 26471730 | |
196 | Phosphorylation | VHSLEQQSEITPKQI CCCHHHCCCCCCCEE | 30.57 | 28555341 | |
199 | Phosphorylation | LEQQSEITPKQITCR HHHCCCCCCCEEEEE | 22.00 | 21712546 | |
201 | Ubiquitination | QQSEITPKQITCRTR HCCCCCCCEEEEECC | 45.76 | - | |
207 | Phosphorylation | PKQITCRTRGSPHPT CCEEEEECCCCCCCC | 41.34 | 29449344 | |
210 | Phosphorylation | ITCRTRGSPHPTSNH EEEECCCCCCCCCCC | 19.42 | 27251275 | |
214 | Phosphorylation | TRGSPHPTSNHWKSQ CCCCCCCCCCCCCCC | 38.84 | 29449344 | |
215 | Phosphorylation | RGSPHPTSNHWKSQH CCCCCCCCCCCCCCC | 31.02 | 29449344 | |
235 | Ubiquitination | LTSNMVCKHCEHQSP CCCCCHHCCCCCCCC | 39.62 | 24896179 | |
289 | Ubiquitination | VVCDNCTKIEAKGTL HCCCCCCEEEEECCC | 40.52 | 24896179 | |
300 | Ubiquitination | KGTLNGEKVEHQRTT ECCCCCCCCEEEEEH | 55.08 | - | |
310 | Ubiquitination | HQRTTFVKQLKLGKL EEEEHHHHHHHCCCC | 45.80 | - | |
335 | Phosphorylation | LSWSSHGTPLKRHEH CCCCCCCCCCCCCCC | 21.74 | - | |
338 | Ubiquitination | SSHGTPLKRHEHVQF CCCCCCCCCCCCCCC | 53.57 | - | |
362 | Ubiquitination | KYHLLGHKPSQHNPK HHHHHCCCCCCCCCC | 44.56 | - | |
364 | Phosphorylation | HLLGHKPSQHNPKLN HHHCCCCCCCCCCCC | 49.20 | 24275569 | |
372 | Ubiquitination | QHNPKLNKNPGPTLE CCCCCCCCCCCCCEE | 74.98 | - | |
388 | Phosphorylation | QDGPGAPTPVLNQPG CCCCCCCCCCCCCCC | 26.04 | 28555341 | |
515 | Phosphorylation | HQSQECKSEE----- HHHHHHHCCC----- | 59.63 | 26471730 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBP30_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIM8A_HUMAN | TIMM8A | physical | 19615732 | |
QKI_HUMAN | QKI | physical | 19615732 | |
SF3A1_HUMAN | SF3A1 | physical | 19615732 | |
CREST_HUMAN | SS18L1 | physical | 19615732 | |
CLPB_HUMAN | CLPB | physical | 19615732 | |
MPND_HUMAN | MPND | physical | 19615732 | |
UBC_HUMAN | UBC | physical | 25527291 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...