UniProt ID | TIM8A_HUMAN | |
---|---|---|
UniProt AC | O60220 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim8 A | |
Gene Name | TIMM8A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 97 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . |
|
Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.. | |
Protein Sequence | MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDSSSSSS -------CCCCCCCC | 11.56 | - | |
3 | Phosphorylation | -----MDSSSSSSAA -----CCCCCCCCCC | 30.71 | 30108239 | |
4 | Phosphorylation | ----MDSSSSSSAAG ----CCCCCCCCCCC | 29.94 | 30108239 | |
5 | Phosphorylation | ---MDSSSSSSAAGL ---CCCCCCCCCCCC | 37.89 | 30108239 | |
6 | Phosphorylation | --MDSSSSSSAAGLG --CCCCCCCCCCCCC | 30.20 | 30108239 | |
7 | Phosphorylation | -MDSSSSSSAAGLGA -CCCCCCCCCCCCCC | 26.41 | 30108239 | |
8 | Phosphorylation | MDSSSSSSAAGLGAV CCCCCCCCCCCCCCC | 24.88 | 30108239 | |
57 | Phosphorylation | KPGPKLDSRAEACFV CCCCCCCHHHHHHHH | 43.77 | 20833797 | |
86 | Ubiquitination | NRLEQTQKSKPVFSE HHHHHHHHCCCCCCC | 64.93 | 21890473 | |
87 | Phosphorylation | RLEQTQKSKPVFSES HHHHHHHCCCCCCCC | 32.16 | 30576142 | |
88 | Acetylation | LEQTQKSKPVFSESL HHHHHHCCCCCCCCC | 52.84 | 7668055 | |
88 | Ubiquitination | LEQTQKSKPVFSESL HHHHHHCCCCCCCCC | 52.84 | 21890473 | |
92 | Phosphorylation | QKSKPVFSESLSD-- HHCCCCCCCCCCC-- | 26.89 | 21955146 | |
94 | Phosphorylation | SKPVFSESLSD---- CCCCCCCCCCC---- | 31.79 | 28355574 | |
96 | Phosphorylation | PVFSESLSD------ CCCCCCCCC------ | 51.02 | 25159151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM8A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM8A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM8A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STAM1_HUMAN | STAM | physical | 12745081 | |
TIM13_HUMAN | TIMM13 | physical | 11875042 | |
K1C15_HUMAN | KRT15 | physical | 25416956 | |
STAM2_HUMAN | STAM2 | physical | 25416956 | |
TIM10_HUMAN | TIMM10 | physical | 26344197 |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-94, AND MASSSPECTROMETRY. |