TIM10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIM10_HUMAN
• UniProt AC: P62072
• Protein Name: Mitochondrial import inner membrane translocase subunit Tim10
• Gene Name: TIMM10
• Organism: Homo sapiens (Human).
• Sequence Length: 90
• Subcellular Localization: Mitochondrion inner membrane ; Peripheral membrane protein ; Intermembrane side .
• Protein Description: Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space..
• Protein Sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Ubiquitination	MTSACHRKCVPPHYK HHHHHHHCCCCCCCH	18.87	29967540
39	Ubiquitination	KCVPPHYKEAELSKG CCCCCCCHHHHHCCC	47.62	-
44	Phosphorylation	HYKEAELSKGESVCL CCHHHHHCCCCCHHH	30.07	24719451
45	Ubiquitination	YKEAELSKGESVCLD CHHHHHCCCCCHHHH	78.35	32015554
50	Glutathionylation	LSKGESVCLDRCVSK HCCCCCHHHHHHHHH	4.56	22555962
53	Methylation	GESVCLDRCVSKYLD CCCHHHHHHHHHHHH	15.13	115918493
57	Ubiquitination	CLDRCVSKYLDIHER HHHHHHHHHHHHHHH	29.45	23000965
57	Acetylation	CLDRCVSKYLDIHER HHHHHHHHHHHHHHH	29.45	25953088
58	Phosphorylation	LDRCVSKYLDIHERM HHHHHHHHHHHHHHH	11.33	27642862
67	Ubiquitination	DIHERMGKKLTELSM HHHHHHHHHHHHHHH	34.95	29967540
70	Phosphorylation	ERMGKKLTELSMQDE HHHHHHHHHHHHCHH	43.70	26074081
73	Phosphorylation	GKKLTELSMQDEELM HHHHHHHHHCHHHHH	14.25	26074081
74	Sulfoxidation	KKLTELSMQDEELMK HHHHHHHHCHHHHHH	10.21	21406390
81	Ubiquitination	MQDEELMKRVQQSSG HCHHHHHHHHHHHCC	63.14	22817900
86	Phosphorylation	LMKRVQQSSGPA--- HHHHHHHHCCCC---	21.85	28102081
87	Phosphorylation	MKRVQQSSGPA---- HHHHHHHCCCC----	44.45	28102081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIM10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIM10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIM10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIM9_HUMAN	TIMM9	physical	22939629
TIM9_HUMAN	TIMM9	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.