UniProt ID | TIM9_HUMAN | |
---|---|---|
UniProt AC | Q9Y5J7 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim9 | |
Gene Name | TIMM9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 89 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . |
|
Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.. | |
Protein Sequence | MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAQIPESD ------CCCCCCCHH | 14.20 | 19413330 | |
15 | Succinylation | SDQIKQFKEFLGTYN HHHHHHHHHHHHHHH | 45.09 | 23954790 | |
34 | Ubiquitination | TCFLDCVKDFTTREV HHHHHHHCCCCCCCC | 54.15 | - | |
46 | Phosphorylation | REVKPEETTCSEHCL CCCCCCCCCCCHHHH | 31.29 | - | |
55 | Acetylation | CSEHCLQKYLKMTQR CCHHHHHHHHHHHHH | 39.33 | 27452117 | |
58 | Acetylation | HCLQKYLKMTQRISM HHHHHHHHHHHHHHH | 36.49 | 27452117 | |
70 | Phosphorylation | ISMRFQEYHIQQNEA HHHHHHHHHHHHHHH | 8.08 | 27642862 | |
81 | Ubiquitination | QNEALAAKAGLLGQP HHHHHHHHHHHCCCC | 37.06 | 21890473 | |
81 | Ubiquitination | QNEALAAKAGLLGQP HHHHHHHHHHHCCCC | 37.06 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UCRI_HUMAN | UQCRFS1 | physical | 22939629 | |
COX5A_HUMAN | COX5A | physical | 26344197 | |
NUDC_HUMAN | NUDC | physical | 26344197 | |
TEBP_HUMAN | PTGES3 | physical | 26344197 | |
TIM10_HUMAN | TIMM10 | physical | 26344197 | |
TIM13_HUMAN | TIMM13 | physical | 26344197 | |
TIM8A_HUMAN | TIMM8A | physical | 26344197 | |
TIM8B_HUMAN | TIMM8B | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |