UniProt ID | TIM8B_HUMAN | |
---|---|---|
UniProt AC | Q9Y5J9 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim8 B | |
Gene Name | TIMM8B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 83 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side. |
|
Protein Description | Probable mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity).. | |
Protein Sequence | MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAELGEADE ------CCCCCCCCH | 22.26 | 22223895 | |
43 | Ubiquitination | CWDKCVEKPGNRLDS HHHHHHCCCCCCCCH | 37.52 | 21906983 | |
50 | Phosphorylation | KPGNRLDSRTENCLS CCCCCCCHHHHHHHH | 45.77 | 28348404 | |
52 | Phosphorylation | GNRLDSRTENCLSSC CCCCCHHHHHHHHHH | 35.19 | 28348404 | |
58 | Ubiquitination | RTENCLSSCVDRFID HHHHHHHHHHHHHHH | 12.76 | - | |
65 | Phosphorylation | SCVDRFIDTTLAITS HHHHHHHHHHHHHHH | 30.81 | 27251275 | |
80 | Ubiquitination | RFAQIVQKGGQ---- HHHHHHHCCCC---- | 54.86 | 21906983 | |
80 | Acetylation | RFAQIVQKGGQ---- HHHHHHHCCCC---- | 54.86 | 25953088 | |
95 | Ubiquitination | ------------------- ------------------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM8B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM8B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM8B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIM8B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |