| UniProt ID | QKI_HUMAN | |
|---|---|---|
| UniProt AC | Q96PU8 | |
| Protein Name | Protein quaking | |
| Gene Name | QKI | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 341 | |
| Subcellular Localization | Nucleus. Cytoplasm. | |
| Protein Description | RNA-binding protein that plays a central role in myelinization. [PubMed: 16641098 Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability] | |
| Protein Sequence | MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MVGEMETKEKPKPTP CCCCCCCCCCCCCCH | 50.89 | 25953088 | |
| 10 | Ubiquitination | GEMETKEKPKPTPDY CCCCCCCCCCCCHHH | 60.95 | - | |
| 25 | Ubiquitination | LMQLMNDKKLMSSLP HHHHHCCHHHHHCCC | 42.68 | - | |
| 26 | Ubiquitination | MQLMNDKKLMSSLPN HHHHCCHHHHHCCCC | 52.89 | - | |
| 57 | Phosphorylation | SRVRKDMYNDTLNGS HHHHHHHHCCCCCCC | 21.74 | 25219547 | |
| 60 | Phosphorylation | RKDMYNDTLNGSTEK HHHHHCCCCCCCCCC | 20.63 | 25219547 | |
| 64 | Phosphorylation | YNDTLNGSTEKRSAE HCCCCCCCCCCCCCC | 32.11 | 25219547 | |
| 65 | Phosphorylation | NDTLNGSTEKRSAEL CCCCCCCCCCCCCCC | 47.10 | 25219547 | |
| 67 | Ubiquitination | TLNGSTEKRSAELPD CCCCCCCCCCCCCCC | 52.30 | - | |
| 69 | Phosphorylation | NGSTEKRSAELPDAV CCCCCCCCCCCCCCC | 36.84 | 29255136 | |
| 87 | Phosphorylation | VQLQEKLYVPVKEYP HEEECCEECCHHHCC | 17.49 | 26437602 | |
| 91 (in isoform 8) | Ubiquitination | - | 45.52 | 21890473 | |
| 91 (in isoform 6) | Ubiquitination | - | 45.52 | 21890473 | |
| 91 (in isoform 5) | Ubiquitination | - | 45.52 | 21890473 | |
| 91 (in isoform 3) | Ubiquitination | - | 45.52 | 21890473 | |
| 91 | Ubiquitination | EKLYVPVKEYPDFNF CCEECCHHHCCCCCC | 45.52 | 21890473 | |
| 91 (in isoform 1) | Ubiquitination | - | 45.52 | 21890473 | |
| 111 (in isoform 8) | Ubiquitination | - | 50.62 | 21890473 | |
| 111 | Ubiquitination | GPRGLTAKQLEAETG CCCCCCHHHHHHHHC | 50.62 | 2190698 | |
| 111 (in isoform 1) | Ubiquitination | - | 50.62 | 21890473 | |
| 111 (in isoform 3) | Ubiquitination | - | 50.62 | 21890473 | |
| 111 (in isoform 5) | Ubiquitination | - | 50.62 | 21890473 | |
| 111 (in isoform 6) | Ubiquitination | - | 50.62 | 21890473 | |
| 188 | Phosphorylation | PAAEGEDSLKKMQLM CCCCCCCHHHHHHHH | 37.47 | 28348404 | |
| 190 | 2-Hydroxyisobutyrylation | AEGEDSLKKMQLMEL CCCCCHHHHHHHHHH | 50.59 | - | |
| 190 | Sumoylation | AEGEDSLKKMQLMEL CCCCCHHHHHHHHHH | 50.59 | - | |
| 190 | Ubiquitination | AEGEDSLKKMQLMEL CCCCCHHHHHHHHHH | 50.59 | - | |
| 190 | Acetylation | AEGEDSLKKMQLMEL CCCCCHHHHHHHHHH | 50.59 | 26051181 | |
| 191 | Ubiquitination | EGEDSLKKMQLMELA CCCCHHHHHHHHHHH | 36.85 | - | |
| 203 | Phosphorylation | ELAILNGTYRDANIK HHHHHCCCCCCCCCC | 17.82 | 24719451 | |
| 210 | Ubiquitination | TYRDANIKSPALAFS CCCCCCCCCHHHHHH | 50.63 | - | |
| 211 (in isoform 5) | Phosphorylation | - | 16.17 | 25849741 | |
| 211 | Phosphorylation | YRDANIKSPALAFSL CCCCCCCCHHHHHHH | 16.17 | 29255136 | |
| 211 (in isoform 3) | Phosphorylation | - | 16.17 | 25849741 | |
| 213 (in isoform 5) | Phosphorylation | - | 20.72 | 28450419 | |
| 213 (in isoform 3) | Phosphorylation | - | 20.72 | 28450419 | |
| 217 | O-linked_Glycosylation | KSPALAFSLAATAQA CCHHHHHHHHHHHHH | 16.11 | 23301498 | |
| 219 (in isoform 3) | Methylation | - | 11.10 | - | |
| 227 | Methylation | ATAQAAPRIITGPAP HHHHHCCCEECCCCC | 28.37 | 24129315 | |
| 242 | Methylation | VLPPAALRTPTPAGP CCCHHHHCCCCCCCC | 33.65 | 24129315 | |
| 242 | Asymmetric dimethylarginine | VLPPAALRTPTPAGP CCCHHHHCCCCCCCC | 33.65 | - | |
| 243 | Phosphorylation | LPPAALRTPTPAGPT CCHHHHCCCCCCCCC | 32.15 | 25850435 | |
| 245 | Phosphorylation | PAALRTPTPAGPTIM HHHHCCCCCCCCCHH | 25.76 | 25850435 | |
| 256 | Methylation | PTIMPLIRQIQTAVM CCHHHHHHHHHHHCC | 34.92 | 54558433 | |
| 336 | Methylation | QRIVTADRAATGN-- CEEEECCHHHCCC-- | 24.53 | 82954759 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QKI_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QKI_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QKI_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
