SOSB2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SOSB2_HUMAN
• UniProt AC: Q96AH0
• Protein Name: SOSS complex subunit B2
• Gene Name: NABP1
• Organism: Homo sapiens (Human).
• Sequence Length: 204
• Subcellular Localization: Nucleus . Localizes to nuclear foci following DNA damage.
• Protein Description: Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways..
• Protein Sequence: MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Ubiquitination	IGRVTKTKDGHEVRS ECCEEECCCCCEEEE	64.37	24816145
87	Phosphorylation	SMWKGCLTLYTGRGG HHHCCEEEEEECCCC	23.07	29083192
89	Phosphorylation	WKGCLTLYTGRGGEL HCCEEEEEECCCCCE	11.25	29083192
90	Phosphorylation	KGCLTLYTGRGGELQ CCEEEEEECCCCCEE	24.42	29083192
135	Phosphorylation	QSEQKNNSMNSNMGT CCHHHHHCCCCCCCC	28.83	26503514
138	Phosphorylation	QKNNSMNSNMGTGTF HHHHCCCCCCCCCCC	21.39	26503514
158	Phosphorylation	GVHTGPESREHQFSH CCCCCCCCCCCCCCC	46.21	26503514
172	Methylation	HAGRSNGRGLINPQL CCCCCCCCCCCCHHH	40.78	115485979
182	Phosphorylation	INPQLQGTASNQTVM CCHHHCCCCCCCEEE	17.60	22798277
184	Phosphorylation	PQLQGTASNQTVMTT HHHCCCCCCCEEEEE	29.34	22798277
191	Phosphorylation	SNQTVMTTISNGRDP CCCEEEEEEECCCCH	12.33	22798277

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SOSB2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SOSB2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SOSB2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
INT3_HUMAN	INTS3	physical	19683501
SOSSC_HUMAN	INIP	physical	19683501
KHDR2_HUMAN	KHDRBS2	physical	25416956
RPB1_HUMAN	POLR2A	physical	26496610
2AAA_HUMAN	PPP2R1A	physical	26496610
XPO1_HUMAN	XPO1	physical	26496610
INT6_HUMAN	INTS6	physical	26496610
ASTE1_HUMAN	ASTE1	physical	26496610
GOT1B_HUMAN	GOLT1B	physical	26496610
INT11_HUMAN	CPSF3L	physical	26496610
AGGF1_HUMAN	AGGF1	physical	26496610
SOSSC_HUMAN	INIP	physical	26496610
INT3_HUMAN	INTS3	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.