UniProt ID | GOT1B_HUMAN | |
---|---|---|
UniProt AC | Q9Y3E0 | |
Protein Name | Vesicle transport protein GOT1B | |
Gene Name | GOLT1B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 138 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in fusion of ER-derived transport vesicles with the Golgi complex.. | |
Protein Sequence | MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MISLTDTQ -------CCCCCCHH | 4.19 | 22223895 | |
62 | Ubiquitination | TFRFFFQKHKMKATG HHHHHHHHHCCHHHC | 39.78 | 22817900 | |
64 | Ubiquitination | RFFFQKHKMKATGFF HHHHHHHCCHHHCHH | 49.48 | 22817900 | |
66 | Ubiquitination | FFQKHKMKATGFFLG HHHHHCCHHHCHHHC | 47.83 | 22817900 | |
130 | Ubiquitination | GIRSFVDKVGESNNM CHHHHHHHHCCCCCC | 47.00 | 21906983 | |
137 | Sulfoxidation | KVGESNNMV------ HHCCCCCCC------ | 4.41 | 21406390 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GOT1B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GOT1B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOT1B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...