| UniProt ID | PLRKT_HUMAN | |
|---|---|---|
| UniProt AC | Q9HBL7 | |
| Protein Name | Plasminogen receptor (KT) | |
| Gene Name | PLGRKT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 147 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/PLAUR.. |
|
| Protein Description | Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9.. | |
| Protein Sequence | MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MGFIFSKSMNESM --CCCCCCCCCCHHH | 21.00 | 24719451 | |
| 8 | Phosphorylation | MGFIFSKSMNESMKN CCCCCCCCCCHHHHH | 26.16 | 20068231 | |
| 12 | Phosphorylation | FSKSMNESMKNQKEF CCCCCCHHHHHHHHH | 30.01 | 20068231 | |
| 14 | Acetylation | KSMNESMKNQKEFML CCCCHHHHHHHHHHH | 66.56 | 25953088 | |
| 17 | Acetylation | NESMKNQKEFMLMNA CHHHHHHHHHHHHHH | 63.41 | 26051181 | |
| 50 | Phosphorylation | MAMQIAWSREFLKYF HHHHHHHHHHHHHHH | 16.95 | 29083192 | |
| 93 | Phosphorylation | PLSFILTYQYDLGYG CHHHHHHHHHCCCHH | 11.13 | - | |
| 95 | Phosphorylation | SFILTYQYDLGYGTL HHHHHHHHCCCHHHH | 11.61 | - | |
| 129 | Phosphorylation | QLPRGMITFESIEKA CCCCCCCCHHHHHHH | 16.68 | 24641631 | |
| 132 | Phosphorylation | RGMITFESIEKARKE CCCCCHHHHHHHHHH | 31.68 | 24641631 | |
| 135 | 2-Hydroxyisobutyrylation | ITFESIEKARKEQSR CCHHHHHHHHHHHHC | 52.39 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLRKT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLRKT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLRKT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| XRCC6_HUMAN | XRCC6 | physical | 16169070 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
