UniProt ID | PLRKT_HUMAN | |
---|---|---|
UniProt AC | Q9HBL7 | |
Protein Name | Plasminogen receptor (KT) | |
Gene Name | PLGRKT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/PLAUR.. |
|
Protein Description | Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metallproteinase activation, such as of MMP2 and MMP9.. | |
Protein Sequence | MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MGFIFSKSMNESM --CCCCCCCCCCHHH | 21.00 | 24719451 | |
8 | Phosphorylation | MGFIFSKSMNESMKN CCCCCCCCCCHHHHH | 26.16 | 20068231 | |
12 | Phosphorylation | FSKSMNESMKNQKEF CCCCCCHHHHHHHHH | 30.01 | 20068231 | |
14 | Acetylation | KSMNESMKNQKEFML CCCCHHHHHHHHHHH | 66.56 | 25953088 | |
17 | Acetylation | NESMKNQKEFMLMNA CHHHHHHHHHHHHHH | 63.41 | 26051181 | |
50 | Phosphorylation | MAMQIAWSREFLKYF HHHHHHHHHHHHHHH | 16.95 | 29083192 | |
93 | Phosphorylation | PLSFILTYQYDLGYG CHHHHHHHHHCCCHH | 11.13 | - | |
95 | Phosphorylation | SFILTYQYDLGYGTL HHHHHHHHCCCHHHH | 11.61 | - | |
129 | Phosphorylation | QLPRGMITFESIEKA CCCCCCCCHHHHHHH | 16.68 | 24641631 | |
132 | Phosphorylation | RGMITFESIEKARKE CCCCCHHHHHHHHHH | 31.68 | 24641631 | |
135 | 2-Hydroxyisobutyrylation | ITFESIEKARKEQSR CCHHHHHHHHHHHHC | 52.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PLRKT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PLRKT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PLRKT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XRCC6_HUMAN | XRCC6 | physical | 16169070 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...