UniProt ID | PTGES_HUMAN | |
---|---|---|
UniProt AC | O14684 | |
Protein Name | Prostaglandin E synthase | |
Gene Name | PTGES | |
Organism | Homo sapiens (Human). | |
Sequence Length | 152 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).. | |
Protein Sequence | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MPAHSLVMSSPA ---CCCHHHHCCCCH | 25.43 | 24043423 | |
9 | Phosphorylation | PAHSLVMSSPALPAF CCHHHHCCCCHHHHH | 26.20 | 24043423 | |
10 | Phosphorylation | AHSLVMSSPALPAFL CHHHHCCCCHHHHHH | 8.97 | 24043423 | |
20 | Phosphorylation | LPAFLLCSTLLVIKM HHHHHHHHHHHHHHH | 23.27 | 24043423 | |
21 | Phosphorylation | PAFLLCSTLLVIKMY HHHHHHHHHHHHHHH | 24.10 | 24043423 | |
42 | Ubiquitination | GQVRLRKKAFANPED CCHHHHHHHHCCHHH | 42.16 | 33845483 | |
42 | Malonylation | GQVRLRKKAFANPED CCHHHHHHHHCCHHH | 42.16 | 26320211 | |
58 | Phosphorylation | LRHGGPQYCRSDPDV HHHCCCCCCCCCHHH | 7.92 | 29214152 | |
61 | Phosphorylation | GGPQYCRSDPDVERC CCCCCCCCCHHHHHH | 50.35 | 28152594 | |
120 | Ubiquitination | HTVAYLGKLRAPIRS HHHHHHHHCHHCHHH | 32.00 | 21963094 | |
120 | 2-Hydroxyisobutyrylation | HTVAYLGKLRAPIRS HHHHHHHHCHHCHHH | 32.00 | - | |
148 | Ubiquitination | ALQILWEAARHL--- HHHHHHHHHHCC--- | 9.75 | 21963094 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTGES_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTGES_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTGES_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTGES_HUMAN | PTGES | physical | 18682561 | |
PTGES_HUMAN | PTGES | physical | 20369883 | |
PTGES_HUMAN | PTGES | physical | 21797823 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...