UniProt ID | UBAC2_HUMAN | |
---|---|---|
UniProt AC | Q8NBM4 | |
Protein Name | Ubiquitin-associated domain-containing protein 2 | |
Gene Name | UBAC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 344 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Restricts trafficking of FAF2 from the endoplasmic reticulum to lipid droplets.. | |
Protein Sequence | MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MFTSTGSSGL -----CCCCCCCCCC | 24.87 | 23663014 | |
4 | Phosphorylation | ----MFTSTGSSGLY ----CCCCCCCCCCC | 21.36 | 23663014 | |
5 | Phosphorylation | ---MFTSTGSSGLYK ---CCCCCCCCCCCC | 37.72 | 23663014 | |
7 | Phosphorylation | -MFTSTGSSGLYKAP -CCCCCCCCCCCCCC | 22.71 | 23663014 | |
8 | Phosphorylation | MFTSTGSSGLYKAPL CCCCCCCCCCCCCCC | 33.88 | 23663014 | |
11 | Phosphorylation | STGSSGLYKAPLSKS CCCCCCCCCCCCCHH | 14.50 | 23663014 | |
12 (in isoform 5) | Ubiquitination | - | 48.87 | 21890473 | |
12 | Ubiquitination | TGSSGLYKAPLSKSL CCCCCCCCCCCCHHH | 48.87 | 21890473 | |
12 (in isoform 4) | Ubiquitination | - | 48.87 | 21906983 | |
12 (in isoform 1) | Ubiquitination | - | 48.87 | 21890473 | |
16 (in isoform 2) | Phosphorylation | - | 21.09 | 24719451 | |
16 | Phosphorylation | GLYKAPLSKSLLLVP CCCCCCCCHHHCHHH | 21.09 | - | |
48 (in isoform 2) | Phosphorylation | - | 4.08 | - | |
53 (in isoform 2) | Phosphorylation | - | 36.88 | - | |
125 (in isoform 5) | Phosphorylation | - | 51.77 | 26552605 | |
161 | N-linked_Glycosylation | LGPLSITNKTLIYIL HCCHHCCCCHHHHHH | 33.38 | UniProtKB CARBOHYD | |
223 | Phosphorylation | WTLEPIFSSSEPTSE HHCCCCCCCCCCCCC | 33.40 | - | |
224 | Phosphorylation | TLEPIFSSSEPTSEA HCCCCCCCCCCCCCC | 28.15 | - | |
257 | Phosphorylation | LDRQLMFSQFAQGRR HHHHHHHHHHHHHHH | 15.49 | 20068231 | |
296 | Phosphorylation | NYQGGRQSEPAAPPL CCCCCCCCCCCCCCC | 44.16 | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBAC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBAC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBAC2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...