| UniProt ID | UBAC2_HUMAN | |
|---|---|---|
| UniProt AC | Q8NBM4 | |
| Protein Name | Ubiquitin-associated domain-containing protein 2 | |
| Gene Name | UBAC2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 344 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Restricts trafficking of FAF2 from the endoplasmic reticulum to lipid droplets.. | |
| Protein Sequence | MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MFTSTGSSGL -----CCCCCCCCCC | 24.87 | 23663014 | |
| 4 | Phosphorylation | ----MFTSTGSSGLY ----CCCCCCCCCCC | 21.36 | 23663014 | |
| 5 | Phosphorylation | ---MFTSTGSSGLYK ---CCCCCCCCCCCC | 37.72 | 23663014 | |
| 7 | Phosphorylation | -MFTSTGSSGLYKAP -CCCCCCCCCCCCCC | 22.71 | 23663014 | |
| 8 | Phosphorylation | MFTSTGSSGLYKAPL CCCCCCCCCCCCCCC | 33.88 | 23663014 | |
| 11 | Phosphorylation | STGSSGLYKAPLSKS CCCCCCCCCCCCCHH | 14.50 | 23663014 | |
| 12 (in isoform 5) | Ubiquitination | - | 48.87 | 21890473 | |
| 12 | Ubiquitination | TGSSGLYKAPLSKSL CCCCCCCCCCCCHHH | 48.87 | 21890473 | |
| 12 (in isoform 4) | Ubiquitination | - | 48.87 | 21906983 | |
| 12 (in isoform 1) | Ubiquitination | - | 48.87 | 21890473 | |
| 16 (in isoform 2) | Phosphorylation | - | 21.09 | 24719451 | |
| 16 | Phosphorylation | GLYKAPLSKSLLLVP CCCCCCCCHHHCHHH | 21.09 | - | |
| 48 (in isoform 2) | Phosphorylation | - | 4.08 | - | |
| 53 (in isoform 2) | Phosphorylation | - | 36.88 | - | |
| 125 (in isoform 5) | Phosphorylation | - | 51.77 | 26552605 | |
| 161 | N-linked_Glycosylation | LGPLSITNKTLIYIL HCCHHCCCCHHHHHH | 33.38 | UniProtKB CARBOHYD | |
| 223 | Phosphorylation | WTLEPIFSSSEPTSE HHCCCCCCCCCCCCC | 33.40 | - | |
| 224 | Phosphorylation | TLEPIFSSSEPTSEA HCCCCCCCCCCCCCC | 28.15 | - | |
| 257 | Phosphorylation | LDRQLMFSQFAQGRR HHHHHHHHHHHHHHH | 15.49 | 20068231 | |
| 296 | Phosphorylation | NYQGGRQSEPAAPPL CCCCCCCCCCCCCCC | 44.16 | 28555341 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBAC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBAC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBAC2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
