UniProt ID | KLK7_HUMAN | |
---|---|---|
UniProt AC | P49862 | |
Protein Name | Kallikrein-7 | |
Gene Name | KLK7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 253 | |
Subcellular Localization | Secreted . In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front. | |
Protein Description | May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.. | |
Protein Sequence | MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
96 | Phosphorylation | RAQRIKASKSFRHPG HHHHHHHCCCCCCCC | 24.67 | 28634298 | |
98 | Phosphorylation | QRIKASKSFRHPGYS HHHHHCCCCCCCCCC | 25.64 | 28634298 | |
104 | Phosphorylation | KSFRHPGYSTQTHVN CCCCCCCCCCCCCCC | 17.00 | 28634298 | |
105 | Phosphorylation | SFRHPGYSTQTHVND CCCCCCCCCCCCCCC | 21.69 | 28634298 | |
106 | Phosphorylation | FRHPGYSTQTHVNDL CCCCCCCCCCCCCCE | 29.07 | 28634298 | |
108 | Phosphorylation | HPGYSTQTHVNDLML CCCCCCCCCCCCEEE | 28.07 | 28634298 | |
120 | Phosphorylation | LMLVKLNSQARLSSM EEEEECCCHHHHHHH | 35.34 | - | |
125 | Phosphorylation | LNSQARLSSMVKKVR CCCHHHHHHHHHHCC | 15.72 | - | |
161 | Phosphorylation | SPDVTFPSDLMCVDV CCCCCCCCCCEEEEE | 38.90 | - | |
187 | Phosphorylation | YKDLLENSMLCAGIP HHHHHHCCCCCCCCC | 12.08 | 20068231 | |
196 | Phosphorylation | LCAGIPDSKKNACNG CCCCCCCCCCCCCCC | 39.93 | 20068231 | |
246 | N-linked_Glycosylation | CKFTKWINDTMKKHR HHHHHHHHHHHHHCC | 37.27 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLK7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLK7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLK7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDSN_HUMAN | CDSN | physical | 15140227 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...