UniProt ID | KPRP_HUMAN | |
---|---|---|
UniProt AC | Q5T749 | |
Protein Name | Keratinocyte proline-rich protein | |
Gene Name | KPRP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 579 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVSDQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYVQCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQPSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRPRPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIPLPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
305 | Phosphorylation | PRRSEPIYNSRCPRR CCCCCCCCCCCCCCC | 20.15 | - | |
315 | Phosphorylation | RCPRRPISSCSQRRG CCCCCCCCHHHCCCC | 28.16 | 23312004 | |
316 | Phosphorylation | CPRRPISSCSQRRGP CCCCCCCHHHCCCCC | 20.64 | 23312004 | |
318 | Phosphorylation | RRPISSCSQRRGPKC CCCCCHHHCCCCCCC | 28.77 | 23312004 | |
330 | Phosphorylation | PKCRIEISSPCCPRQ CCCEEEECCCCCCCC | 18.55 | 25072903 | |
331 | Phosphorylation | KCRIEISSPCCPRQV CCEEEECCCCCCCCC | 27.84 | 25072903 | |
394 | Phosphorylation | RLDQCPESPLQRCPP CCCCCCCCHHHCCCC | 18.95 | 20166139 | |
415 | Phosphorylation | LRPEPCISLEPRPRP CCCCCCCCCCCCCCC | 33.14 | 25072903 | |
428 | Phosphorylation | RPLPRQLSEPCLYPE CCCCCCCCCCCCCCC | 31.02 | 20068231 | |
433 | Phosphorylation | QLSEPCLYPEPLPAL CCCCCCCCCCCCCCC | 16.56 | 20068231 | |
443 | Phosphorylation | PLPALRPTPRPVPLP CCCCCCCCCCCCCCC | 26.04 | 20068231 | |
487 | Phosphorylation | PLPAPCPSPEPCRET CCCCCCCCCCCCCCC | 48.92 | 28122231 | |
497 | Phosphorylation | PCRETWRSPSPCWGP CCCCCCCCCCCCCCC | 22.69 | 25072903 | |
499 | Phosphorylation | RETWRSPSPCWGPNP CCCCCCCCCCCCCCC | 33.66 | 25072903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KPRP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KPRP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KPRP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KPRP_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...