| UniProt ID | KPRP_HUMAN | |
|---|---|---|
| UniProt AC | Q5T749 | |
| Protein Name | Keratinocyte proline-rich protein | |
| Gene Name | KPRP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 579 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | ||
| Protein Sequence | MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVSDQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYVQCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQPSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRPRPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIPLPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 305 | Phosphorylation | PRRSEPIYNSRCPRR CCCCCCCCCCCCCCC | 20.15 | - | |
| 315 | Phosphorylation | RCPRRPISSCSQRRG CCCCCCCCHHHCCCC | 28.16 | 23312004 | |
| 316 | Phosphorylation | CPRRPISSCSQRRGP CCCCCCCHHHCCCCC | 20.64 | 23312004 | |
| 318 | Phosphorylation | RRPISSCSQRRGPKC CCCCCHHHCCCCCCC | 28.77 | 23312004 | |
| 330 | Phosphorylation | PKCRIEISSPCCPRQ CCCEEEECCCCCCCC | 18.55 | 25072903 | |
| 331 | Phosphorylation | KCRIEISSPCCPRQV CCEEEECCCCCCCCC | 27.84 | 25072903 | |
| 394 | Phosphorylation | RLDQCPESPLQRCPP CCCCCCCCHHHCCCC | 18.95 | 20166139 | |
| 415 | Phosphorylation | LRPEPCISLEPRPRP CCCCCCCCCCCCCCC | 33.14 | 25072903 | |
| 428 | Phosphorylation | RPLPRQLSEPCLYPE CCCCCCCCCCCCCCC | 31.02 | 20068231 | |
| 433 | Phosphorylation | QLSEPCLYPEPLPAL CCCCCCCCCCCCCCC | 16.56 | 20068231 | |
| 443 | Phosphorylation | PLPALRPTPRPVPLP CCCCCCCCCCCCCCC | 26.04 | 20068231 | |
| 487 | Phosphorylation | PLPAPCPSPEPCRET CCCCCCCCCCCCCCC | 48.92 | 28122231 | |
| 497 | Phosphorylation | PCRETWRSPSPCWGP CCCCCCCCCCCCCCC | 22.69 | 25072903 | |
| 499 | Phosphorylation | RETWRSPSPCWGPNP CCCCCCCCCCCCCCC | 33.66 | 25072903 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KPRP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KPRP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KPRP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KPRP_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
