TM199_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM199_HUMAN
• UniProt AC: Q8N511
• Protein Name: Transmembrane protein 199 {ECO:0000303|PubMed:26833330}
• Gene Name: TMEM199 {ECO:0000303|PubMed:26833330, ECO:0000312|HGNC:HGNC:18085}
• Organism: Homo sapiens (Human).
• Sequence Length: 208
• Subcellular Localization: Cytoplasmic vesicle, COPI-coated vesicle membrane ; Multi-pass membrane protein . Endoplasmic reticulum-Golgi intermediate compartment membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane ; Multi-pass membrane protein . Partial col
• Protein Description: Accessory component of the proton-transporting vacuolar (V)-ATPase protein pump involved in intracellular iron homeostasis. In aerobic conditions, required for intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. Necessary for endolysosomal acidification and lysosomal degradation. [PubMed: 28296633 May be involved in Golgi homeostasis]
• Protein Sequence: MASSLLAGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRERDSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQVRSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASSLLAGE ------CCCHHHHHH	14.07	22223895
3	Phosphorylation	-----MASSLLAGER -----CCCHHHHHHH	21.88	-
4	Phosphorylation	----MASSLLAGERL ----CCCHHHHHHHH	20.19	-
40	Ubiquitination	ELEAALGKKHKGGDS HHHHHHCCCCCCCCC	53.18	27667366
107	Ubiquitination	VARLEKIKIQLANEE HHHHHHHHHHHCCHH	35.15	33845483
115	Phosphorylation	IQLANEEYKRITRNV HHHCCHHHHHHHCCC	10.21	-
116	Ubiquitination	QLANEEYKRITRNVT HHCCHHHHHHHCCCC	40.37	21906983
123	Phosphorylation	KRITRNVTCQDTRHG HHHHCCCCCCCCCCC	14.16	26699800
138	Ubiquitination	GTLSDLGKQVRSLKA CCHHHHHHHHHHHHH	53.57	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM199_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM199_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM199_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KASH5_HUMAN	CCDC155	physical	25416956
VPP2_HUMAN	ATP6V0A2	physical	28514442
RENR_HUMAN	ATP6AP2	physical	28514442
VA0D1_HUMAN	ATP6V0D1	physical	28514442
VMA21_HUMAN	VMA21	physical	28514442
VATL_HUMAN	ATP6V0C	physical	28514442
CC115_HUMAN	CCDC115	physical	28514442
MBRL_HUMAN	TMEM259	physical	28514442
VPP1_HUMAN	ATP6V0A1	physical	28514442
ECM29_HUMAN	KIAA0368	physical	28514442
CLH2_HUMAN	CLTCL1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.