UniProt ID | VATL_HUMAN | |
---|---|---|
UniProt AC | P27449 | |
Protein Name | V-type proton ATPase 16 kDa proteolipid subunit | |
Gene Name | ATP6V0C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 155 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein. |
|
Protein Description | Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
Protein Sequence | MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | KSGPEYASFFAVMGA CCCHHHHHHHHHHHH | 21.72 | - | |
37 | Phosphorylation | AAYGTAKSGTGIAAM HHHCCCCCCCCCHHH | 38.84 | 20068231 | |
39 | Phosphorylation | YGTAKSGTGIAAMSV HCCCCCCCCCHHHCC | 32.29 | 20068231 | |
45 | Phosphorylation | GTGIAAMSVMRPEQI CCCCHHHCCCCHHHH | 14.18 | 20068231 | |
153 | Phosphorylation | LIVALILSTK----- HHHHHHHCCC----- | 27.44 | 24719451 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CERS2_HUMAN | CERS2 | physical | 11543633 | |
CERS2_HUMAN | CERS2 | physical | 21988832 | |
CLIC1_HUMAN | CLIC1 | physical | 21988832 | |
EDA_HUMAN | EDA | physical | 25416956 | |
MSRE_HUMAN | MSR1 | physical | 25416956 | |
PSA3_HUMAN | PSMA3 | physical | 25416956 | |
SMIM3_HUMAN | SMIM3 | physical | 25416956 | |
VA0D1_HUMAN | ATP6V0D1 | physical | 28514442 | |
VPP2_HUMAN | ATP6V0A2 | physical | 28514442 | |
VMA21_HUMAN | VMA21 | physical | 28514442 | |
RENR_HUMAN | ATP6AP2 | physical | 28514442 | |
ATPB_HUMAN | ATP5B | physical | 28514442 | |
CJ035_HUMAN | C10orf35 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...