VATL_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VATL_HUMAN
• UniProt AC: P27449
• Protein Name: V-type proton ATPase 16 kDa proteolipid subunit
• Gene Name: ATP6V0C
• Organism: Homo sapiens (Human).
• Sequence Length: 155
• Subcellular Localization: Vacuole membrane; Multi-pass membrane protein.
• Protein Description: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells..
• Protein Sequence: MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	KSGPEYASFFAVMGA CCCHHHHHHHHHHHH	21.72	-
37	Phosphorylation	AAYGTAKSGTGIAAM HHHCCCCCCCCCHHH	38.84	20068231
39	Phosphorylation	YGTAKSGTGIAAMSV HCCCCCCCCCHHHCC	32.29	20068231
45	Phosphorylation	GTGIAAMSVMRPEQI CCCCHHHCCCCHHHH	14.18	20068231
153	Phosphorylation	LIVALILSTK----- HHHHHHHCCC-----	27.44	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RNF182	Q8N6D2	PMID:18298843

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VATL_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VATL_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CERS2_HUMAN	CERS2	physical	11543633
CERS2_HUMAN	CERS2	physical	21988832
CLIC1_HUMAN	CLIC1	physical	21988832
EDA_HUMAN	EDA	physical	25416956
MSRE_HUMAN	MSR1	physical	25416956
PSA3_HUMAN	PSMA3	physical	25416956
SMIM3_HUMAN	SMIM3	physical	25416956
VA0D1_HUMAN	ATP6V0D1	physical	28514442
VPP2_HUMAN	ATP6V0A2	physical	28514442
VMA21_HUMAN	VMA21	physical	28514442
RENR_HUMAN	ATP6AP2	physical	28514442
ATPB_HUMAN	ATP5B	physical	28514442
CJ035_HUMAN	C10orf35	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.