| UniProt ID | NDUV3_HUMAN | |
|---|---|---|
| UniProt AC | P56181 | |
| Protein Name | NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial | |
| Gene Name | NDUFV3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 108 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. May be the terminally assembled subunit of Complex I.. | |
| Protein Sequence | MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 53 | Phosphorylation | PQNSKKQSPPKKPAP CCCCCCCCCCCCCCC | 52.64 | 29214152 | |
| 53 (in isoform 2) | Phosphorylation | - | 52.64 | 21712546 | |
| 70 | Phosphorylation | AEPFDNTTYKNLQHH CCCCCCCCCCCCCCC | 38.46 | 20068231 | |
| 70 (in isoform 2) | Phosphorylation | - | 38.46 | 20068231 | |
| 72 | Phosphorylation | PFDNTTYKNLQHHDY CCCCCCCCCCCCCCC | 49.44 | - | |
| 72 (in isoform 2) | Phosphorylation | - | 49.44 | 20068231 | |
| 77 | Phosphorylation | TYKNLQHHDYSTYTF CCCCCCCCCCCEEEE | 23.81 | - | |
| 77 (in isoform 2) | Phosphorylation | - | 23.81 | 20068231 | |
| 82 | Phosphorylation | QHHDYSTYTFLDLNL CCCCCCEEEEEEECE | 6.91 | - | |
| 82 (in isoform 2) | Phosphorylation | - | 6.91 | 28674419 | |
| 86 (in isoform 2) | Phosphorylation | - | 29.35 | 28985074 | |
| 98 (in isoform 2) | Phosphorylation | - | 40.96 | 30266825 | |
| 98 | Phosphorylation | LSKFRMPQPSSGRES EHHCCCCCCCCCCCC | 40.96 | 24719451 | |
| 100 | Phosphorylation | KFRMPQPSSGRESPR HCCCCCCCCCCCCCC | 39.93 | 23401153 | |
| 100 (in isoform 2) | Phosphorylation | - | 39.93 | 30266825 | |
| 101 | Phosphorylation | FRMPQPSSGRESPRH CCCCCCCCCCCCCCC | 48.86 | 23401153 | |
| 102 (in isoform 2) | Phosphorylation | - | 41.53 | 30266825 | |
| 104 (in isoform 2) | Phosphorylation | - | 69.49 | 30266825 | |
| 104 | Phosphorylation | PQPSSGRESPRH--- CCCCCCCCCCCC--- | 69.49 | - | |
| 105 | Phosphorylation | QPSSGRESPRH---- CCCCCCCCCCC---- | 26.35 | 30266825 | |
| 108 | Phosphorylation | SGRESPRH------- CCCCCCCC------- | 45.47 | - | |
| 108 (in isoform 2) | Phosphorylation | - | 45.47 | 21949786 | |
| 117 | Phosphorylation | ---------------- ---------------- | - | ||
| 117 (in isoform 2) | Phosphorylation | - | - | ||
| 127 | Ubiquitination | -------------------------- -------------------------- | 21890473 | ||
| 127 | Ubiquitination | -------------------------- -------------------------- | 21890473 | ||
| 127 (in isoform 2) | Ubiquitination | - | - | ||
| 130 (in isoform 2) | Phosphorylation | - | 27251275 | ||
| 130 | Phosphorylation | ----------------------------- ----------------------------- | 27251275 | ||
| 137 | Phosphorylation | ------------------------------------ ------------------------------------ | - | ||
| 137 (in isoform 2) | Phosphorylation | - | - | ||
| 149 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 150 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 152 | Phosphorylation | --------------------------------------------------- --------------------------------------------------- | - | ||
| 152 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 153 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 154 | Phosphorylation | ----------------------------------------------------- ----------------------------------------------------- | - | ||
| 154 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 155 | Phosphorylation | ------------------------------------------------------ ------------------------------------------------------ | - | ||
| 155 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 156 | Phosphorylation | ------------------------------------------------------- ------------------------------------------------------- | - | ||
| 156 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 157 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 157 | Phosphorylation | -------------------------------------------------------- -------------------------------------------------------- | - | ||
| 158 | Phosphorylation | --------------------------------------------------------- --------------------------------------------------------- | - | ||
| 158 (in isoform 2) | Phosphorylation | - | 25159151 | ||
| 159 | Phosphorylation | ---------------------------------------------------------- ---------------------------------------------------------- | - | ||
| 159 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 160 | Phosphorylation | ----------------------------------------------------------- ----------------------------------------------------------- | - | ||
| 160 (in isoform 2) | Phosphorylation | - | 22167270 | ||
| 162 | Phosphorylation | ------------------------------------------------------------- ------------------------------------------------------------- | - | ||
| 162 (in isoform 2) | Phosphorylation | - | 22167270 | ||
| 164 | Phosphorylation | --------------------------------------------------------------- --------------------------------------------------------------- | 24719451 | ||
| 164 (in isoform 2) | Phosphorylation | - | 22167270 | ||
| 171 (in isoform 2) | Phosphorylation | - | 23927012 | ||
| 174 (in isoform 2) | Phosphorylation | - | 25262027 | ||
| 182 | Methylation | --------------------------------------------------------------------------------- --------------------------------------------------------------------------------- | - | ||
| 223 (in isoform 2) | Acetylation | - | - | ||
| 223 | Acetylation | -------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------- | 19608861 | ||
| 232 | Phosphorylation | ----------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------- | 24719451 | ||
| 232 (in isoform 2) | Phosphorylation | - | 28985074 | ||
| 237 (in isoform 2) | Phosphorylation | - | 19664995 | ||
| 237 | Phosphorylation | ---------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 247 | Phosphorylation | -------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 247 (in isoform 2) | Phosphorylation | - | 20068231 | ||
| 248 (in isoform 2) | Phosphorylation | - | 24719451 | ||
| 248 | Phosphorylation | --------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------- | 24719451 | ||
| 260 | Methylation | --------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 262 (in isoform 2) | Phosphorylation | - | 23684312 | ||
| 264 | Methylation | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 266 | Methylation | --------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 295 (in isoform 2) | Phosphorylation | - | - | ||
| 295 | Phosphorylation | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 306 (in isoform 2) | Phosphorylation | - | 21815630 | ||
| 306 | Phosphorylation | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 325 (in isoform 2) | Phosphorylation | - | 28985074 | ||
| 325 | Phosphorylation | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | - | ||
| 336 (in isoform 2) | Acetylation | - | - | ||
| 465 | Phosphorylation | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 24719451 | ||
| 470 | Phosphorylation | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 33259812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 105 | S | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUV3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUV3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUV3_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
