| UniProt ID | NDUS5_HUMAN | |
|---|---|---|
| UniProt AC | O43920 | |
| Protein Name | NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 | |
| Gene Name | NDUFS5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 106 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Ubiquitination | MPFLDIQKRFGLNID CCCCCCHHHHCCCCC | 50.45 | 21890473 | |
| 8 | 2-Hydroxyisobutyrylation | MPFLDIQKRFGLNID CCCCCCHHHHCCCCC | 50.45 | - | |
| 28 | Ubiquitination | QSGEQPYKMAGRCHA ECCCCCCCCCCCCCH | 29.02 | 21890473 | |
| 28 | Acetylation | QSGEQPYKMAGRCHA ECCCCCCCCCCCCCH | 29.02 | 27452117 | |
| 38 | Ubiquitination | GRCHAFEKEWIECAH CCCCHHHHHHHHHHH | 52.47 | - | |
| 50 | Phosphorylation | CAHGIGYTRAEKECK HHHHCCCCHHHHHEE | 20.42 | 22210691 | |
| 57 | Ubiquitination | TRAEKECKIEYDDFV CHHHHHEECCHHHHH | 39.40 | - | |
| 88 | Ubiquitination | KQRDKLIKEGKYTPP HHHHHHHHCCCCCCC | 71.50 | - | |
| 91 | Sumoylation | DKLIKEGKYTPPPHH HHHHHCCCCCCCCCC | 47.22 | - | |
| 91 | Sumoylation | DKLIKEGKYTPPPHH HHHHHCCCCCCCCCC | 47.22 | - | |
| 91 | Ubiquitination | DKLIKEGKYTPPPHH HHHHHCCCCCCCCCC | 47.22 | - | |
| 92 | Phosphorylation | KLIKEGKYTPPPHHI HHHHCCCCCCCCCCC | 35.02 | 22210691 | |
| 93 | Phosphorylation | LIKEGKYTPPPHHIG HHHCCCCCCCCCCCC | 32.57 | 22210691 | |
| 101 | Ubiquitination | PPPHHIGKGEPRP-- CCCCCCCCCCCCC-- | 60.54 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUS5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUS5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUS5_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
