NU6M_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NU6M_HUMAN
• UniProt AC: P03923
• Protein Name: NADH-ubiquinone oxidoreductase chain 6
• Gene Name: MT-ND6
• Organism: Homo sapiens (Human).
• Sequence Length: 174
• Subcellular Localization: Mitochondrion membrane ; Multi-pass membrane protein .
• Protein Description: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
• Protein Sequence: MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NU6M_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NU6M_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NU6M_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NU6M_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of NU6M_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.