UniProt ID | TMM70_HUMAN | |
---|---|---|
UniProt AC | Q9BUB7 | |
Protein Name | Transmembrane protein 70, mitochondrial | |
Gene Name | TMEM70 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 260 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Involved in biogenesis of mitochondrial ATP synthase.. | |
Protein Sequence | MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | LPLCGRRTALCAAAA CCCCCHHHHHHHHHH | 23.71 | 22210691 | |
35 | Phosphorylation | ALRGPRASVSRASSS HHHCCCEEECCCCCC | 23.16 | - | |
37 | Phosphorylation | RGPRASVSRASSSSG HCCCEEECCCCCCCC | 21.45 | 28857561 | |
74 | Phosphorylation | GRAQIPVYWEGYVRF CCCCCCEEEEEEEEE | 7.74 | 27642862 | |
84 | Phosphorylation | GYVRFLNTPSDKSED EEEEEECCCCCCCCC | 26.73 | - | |
86 | Phosphorylation | VRFLNTPSDKSEDGR EEEECCCCCCCCCCC | 56.48 | - | |
88 | Ubiquitination | FLNTPSDKSEDGRLI EECCCCCCCCCCCEE | 61.14 | 21906983 | |
88 (in isoform 1) | Ubiquitination | - | 61.14 | 21890473 | |
89 | Phosphorylation | LNTPSDKSEDGRLIY ECCCCCCCCCCCEEE | 46.00 | 24719451 | |
96 | Phosphorylation | SEDGRLIYTGNMARA CCCCCEEECCCHHHH | 17.12 | 29496907 | |
102 (in isoform 2) | Ubiquitination | - | 22.10 | 21890473 | |
118 (in isoform 2) | Ubiquitination | - | 24.77 | 21890473 | |
171 | Phosphorylation | KGYVIRLYHEATTDT CCCEEEEEEECCCCH | 6.43 | - | |
179 | Phosphorylation | HEATTDTYKAITYNA EECCCCHHHHHHHHH | 10.96 | - | |
184 | Phosphorylation | DTYKAITYNAMLAET CHHHHHHHHHHHHCC | 8.53 | - | |
201 | Ubiquitination | VFHQNDVKIPDAKHV EECCCCCCCCCHHHE | 51.92 | 21906983 | |
201 (in isoform 1) | Ubiquitination | - | 51.92 | 21890473 | |
206 | Ubiquitination | DVKIPDAKHVFTTFY CCCCCCHHHEEEEEE | 47.91 | 22817900 | |
206 | Malonylation | DVKIPDAKHVFTTFY CCCCCCHHHEEEEEE | 47.91 | 30639696 | |
213 | Phosphorylation | KHVFTTFYAKTKSLL HHEEEEEEECCHHHE | 12.70 | 29496907 | |
215 | Ubiquitination | VFTTFYAKTKSLLVN EEEEEEECCHHHEEE | 45.14 | 22817900 | |
217 | Ubiquitination | TTFYAKTKSLLVNPV EEEEECCHHHEEECE | 38.10 | 27667366 | |
217 (in isoform 1) | Ubiquitination | - | 38.10 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMM70_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMM70_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMM70_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACS2L_HUMAN | ACSS1 | physical | 28514442 | |
CHDH_HUMAN | CHDH | physical | 28514442 | |
MIPEP_HUMAN | MIPEP | physical | 28514442 | |
SYNM_HUMAN | NARS2 | physical | 28514442 | |
ZMY19_HUMAN | ZMYND19 | physical | 28514442 | |
MCCA_HUMAN | MCCC1 | physical | 28514442 | |
COQ6_HUMAN | COQ6 | physical | 28514442 | |
CPSM_HUMAN | CPS1 | physical | 28514442 | |
CPT2_HUMAN | CPT2 | physical | 28514442 | |
DHRS4_HUMAN | DHRS4 | physical | 28514442 | |
IF2M_HUMAN | MTIF2 | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
ADRO_HUMAN | FDXR | physical | 28514442 | |
ACSF3_HUMAN | ACSF3 | physical | 28514442 | |
MAEA_HUMAN | MAEA | physical | 28514442 | |
TOP3A_HUMAN | TOP3A | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00473 | Mitochondrial respiratory chain deficiencies (MRCD), including: Mitochondrial complex I deficiency ( | |||||
OMIM Disease | ||||||
614052 | Mitochondrial complex V deficiency, nuclear 2 (MC5DN2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...