| UniProt ID | EXTL2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBQ6 | |
| Protein Name | Exostosin-like 2 | |
| Gene Name | EXTL2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 330 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein. Processed exostosin-like 2: Secreted. A soluble form is found in the serum. |
|
| Protein Description | Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.. | |
| Protein Sequence | MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Methylation | HICKLPGRVMGIRVL EECCCCCCCCHHHHH | 17.20 | - | |
| 42 | Phosphorylation | ALTALLPSVKEDKML HHHHHCCCCCHHHHH | 45.87 | 24114839 | |
| 74 | N-linked_Glycosylation | TLIMQTYNRTDLLLK HHHHHHCCHHHHHHH | 43.70 | UniProtKB CARBOHYD | |
| 184 | Phosphorylation | FVPRKHVSTSSGIYS EEECCCEECCCEEEE | 23.45 | 24248375 | |
| 191 | Phosphorylation | STSSGIYSYGSFEMQ ECCCEEEEEEEEEEE | 22.54 | 24248375 | |
| 192 | Phosphorylation | TSSGIYSYGSFEMQA CCCEEEEEEEEEEEC | 10.38 | 24248375 | |
| 194 | Phosphorylation | SGIYSYGSFEMQAPG CEEEEEEEEEEECCC | 15.14 | 24248375 | |
| 208 | Phosphorylation | GSGNGDQYSMVLIGA CCCCCCCEEEEEEEH | 11.95 | 24248375 | |
| 216 | Phosphorylation | SMVLIGASFFNSKYL EEEEEEHHHCCHHHH | 25.76 | 24248375 | |
| 222 | Phosphorylation | ASFFNSKYLELFQRQ HHHCCHHHHHHHHHC | 12.77 | 20068231 | |
| 280 | Phosphorylation | EKETNSGYSGMWHRA HHHCCCCCCCHHHHH | 11.24 | 29083192 | |
| 281 | Phosphorylation | KETNSGYSGMWHRAE HHCCCCCCCHHHHHH | 26.20 | 29083192 | |
| 311 | Phosphorylation | YDSMPLRYSNIMISQ HHHCCCCCCCEEEEC | 17.47 | 29978859 | |
| 312 | Phosphorylation | DSMPLRYSNIMISQF HHCCCCCCCEEEECC | 17.28 | 29978859 | |
| 317 | Phosphorylation | RYSNIMISQFGFPYA CCCCEEEECCCCCCC | 11.32 | 29978859 | |
| 323 | Phosphorylation | ISQFGFPYANYKRKI EECCCCCCCCCCCCC | 12.76 | 29978859 | |
| 326 | Phosphorylation | FGFPYANYKRKI--- CCCCCCCCCCCC--- | 12.19 | 29978859 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EXTL2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EXTL2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EXTL2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EXTL2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
