UniProt ID | EXTL2_HUMAN | |
---|---|---|
UniProt AC | Q9UBQ6 | |
Protein Name | Exostosin-like 2 | |
Gene Name | EXTL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 330 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein. Processed exostosin-like 2: Secreted. A soluble form is found in the serum. |
|
Protein Description | Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.. | |
Protein Sequence | MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNIMISQFGFPYANYKRKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Methylation | HICKLPGRVMGIRVL EECCCCCCCCHHHHH | 17.20 | - | |
42 | Phosphorylation | ALTALLPSVKEDKML HHHHHCCCCCHHHHH | 45.87 | 24114839 | |
74 | N-linked_Glycosylation | TLIMQTYNRTDLLLK HHHHHHCCHHHHHHH | 43.70 | UniProtKB CARBOHYD | |
184 | Phosphorylation | FVPRKHVSTSSGIYS EEECCCEECCCEEEE | 23.45 | 24248375 | |
191 | Phosphorylation | STSSGIYSYGSFEMQ ECCCEEEEEEEEEEE | 22.54 | 24248375 | |
192 | Phosphorylation | TSSGIYSYGSFEMQA CCCEEEEEEEEEEEC | 10.38 | 24248375 | |
194 | Phosphorylation | SGIYSYGSFEMQAPG CEEEEEEEEEEECCC | 15.14 | 24248375 | |
208 | Phosphorylation | GSGNGDQYSMVLIGA CCCCCCCEEEEEEEH | 11.95 | 24248375 | |
216 | Phosphorylation | SMVLIGASFFNSKYL EEEEEEHHHCCHHHH | 25.76 | 24248375 | |
222 | Phosphorylation | ASFFNSKYLELFQRQ HHHCCHHHHHHHHHC | 12.77 | 20068231 | |
280 | Phosphorylation | EKETNSGYSGMWHRA HHHCCCCCCCHHHHH | 11.24 | 29083192 | |
281 | Phosphorylation | KETNSGYSGMWHRAE HHCCCCCCCHHHHHH | 26.20 | 29083192 | |
311 | Phosphorylation | YDSMPLRYSNIMISQ HHHCCCCCCCEEEEC | 17.47 | 29978859 | |
312 | Phosphorylation | DSMPLRYSNIMISQF HHCCCCCCCEEEECC | 17.28 | 29978859 | |
317 | Phosphorylation | RYSNIMISQFGFPYA CCCCEEEECCCCCCC | 11.32 | 29978859 | |
323 | Phosphorylation | ISQFGFPYANYKRKI EECCCCCCCCCCCCC | 12.76 | 29978859 | |
326 | Phosphorylation | FGFPYANYKRKI--- CCCCCCCCCCCC--- | 12.19 | 29978859 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EXTL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EXTL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EXTL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EXTL2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...