| UniProt ID | RBM11_HUMAN | |
|---|---|---|
| UniProt AC | P57052 | |
| Protein Name | Splicing regulator RBM11 | |
| Gene Name | RBM11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 281 | |
| Subcellular Localization |
Nucleus, nucleoplasm . Nucleus speckle . Enriched in SRSF2-containing splicing speckles shuttles between nucleoplasm and speckles. |
|
| Protein Description | Tissue-specific splicing factor with potential implication in the regulation of alternative splicing during neuron and germ cell differentiation. Antagonizes SRSF1-mediated BCL-X splicing. May affect the choice of alternative 5' splice sites by binding to specific sequences in exons and antagonizing the SR protein SRSF1.. | |
| Protein Sequence | MFPAQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 253 | Phosphorylation | KRKRQKQTSDSDSST HHHHCCCCCCCCCCC | 41.35 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RBM11_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RBM11_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RBM11_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RHXF2_HUMAN | RHOXF2 | physical | 16189514 | |
| ZN774_HUMAN | ZNF774 | physical | 25416956 | |
| SF3B2_HUMAN | SF3B2 | physical | 26186194 | |
| SK2L2_HUMAN | SKIV2L2 | physical | 26186194 | |
| UBP7_HUMAN | USP7 | physical | 26186194 | |
| NADAP_HUMAN | SLC4A1AP | physical | 26186194 | |
| ZCHC8_HUMAN | ZCCHC8 | physical | 26186194 | |
| TTC33_HUMAN | TTC33 | physical | 26186194 | |
| DAZP2_HUMAN | DAZAP2 | physical | 21516116 | |
| NADAP_HUMAN | SLC4A1AP | physical | 28514442 | |
| ZCHC8_HUMAN | ZCCHC8 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
