| UniProt ID | SERF2_HUMAN | |
|---|---|---|
| UniProt AC | P84101 | |
| Protein Name | Small EDRK-rich factor 2 | |
| Gene Name | SERF2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 59 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Methylation | -----MTRGNQRELA -----CCHHHHHHHH | 40.54 | 115916477 | |
| 19 | Phosphorylation | QKNMKKQSDSVKGKR HHHHHHHHHHHCCCC | 40.51 | 26074081 | |
| 21 | Phosphorylation | NMKKQSDSVKGKRRD HHHHHHHHHCCCCHH | 30.86 | 26657352 | |
| 23 | Ubiquitination | KKQSDSVKGKRRDDG HHHHHHHCCCCHHHH | 63.77 | 33845483 | |
| 32 | Phosphorylation | KRRDDGLSAAARKQR CCHHHHHHHHHHHHH | 22.76 | 26074081 | |
| 33 | Ubiquitination | RRDDGLSAAARKQRD CHHHHHHHHHHHHHH | 15.35 | 32015554 | |
| 36 | Ubiquitination | DGLSAAARKQRDSEI HHHHHHHHHHHHHHH | 30.80 | 24816145 | |
| 41 | Phosphorylation | AARKQRDSEIMQQKQ HHHHHHHHHHHHHHH | 31.07 | 25159151 | |
| 44 | Sulfoxidation | KQRDSEIMQQKQKKA HHHHHHHHHHHHHHH | 2.79 | 30846556 | |
| 47 | Ubiquitination | DSEIMQQKQKKANEK HHHHHHHHHHHHHHH | 47.39 | 32015554 | |
| 47 | Acetylation | DSEIMQQKQKKANEK HHHHHHHHHHHHHHH | 47.39 | 25953088 | |
| 49 | Ubiquitination | EIMQQKQKKANEKKE HHHHHHHHHHHHHCC | 61.97 | - | |
| 50 | Ubiquitination | IMQQKQKKANEKKEE HHHHHHHHHHHHCCC | 54.68 | 24816145 | |
| 54 | Acetylation | KQKKANEKKEEPK-- HHHHHHHHCCCCC-- | 66.35 | 30592321 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERF2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERF2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERF2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RHXF2_HUMAN | RHOXF2 | physical | 16189514 | |
| PSME3_HUMAN | PSME3 | physical | 16189514 | |
| RBPMS_HUMAN | RBPMS | physical | 16189514 | |
| CHD3_HUMAN | CHD3 | physical | 16169070 | |
| THAP1_HUMAN | THAP1 | physical | 25416956 | |
| BOLL_HUMAN | BOLL | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...