UniProt ID | BOLL_HUMAN | |
---|---|---|
UniProt AC | Q8N9W6 | |
Protein Name | Protein boule-like | |
Gene Name | BOLL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 283 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity).. | |
Protein Sequence | MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 (in isoform 3) | Phosphorylation | - | 26.68 | 24043423 | |
5 (in isoform 3) | Phosphorylation | - | 33.85 | 24043423 | |
9 (in isoform 3) | Phosphorylation | - | 33.65 | 24043423 | |
10 (in isoform 3) | Phosphorylation | - | 53.15 | 29978859 | |
15 (in isoform 3) | Phosphorylation | - | 31.79 | 29978859 | |
17 (in isoform 3) | Phosphorylation | - | 32.52 | 29978859 | |
19 (in isoform 3) | Phosphorylation | - | 46.49 | 29978859 | |
21 (in isoform 3) | Phosphorylation | - | 27.02 | 29978859 | |
26 (in isoform 3) | Phosphorylation | - | 42.08 | 29978859 | |
34 (in isoform 3) | Phosphorylation | - | 20.54 | 29978859 | |
35 (in isoform 3) | Phosphorylation | - | 4.11 | 29978859 | |
51 | Acetylation | TNESDLRKFFSQYGS CCHHHHHHHHHHHCC | 59.04 | 11789935 | |
60 | Ubiquitination | FSQYGSVKEVKIVND HHHHCCEEEEEEEEC | 59.49 | 2190698 | |
63 | Ubiquitination | YGSVKEVKIVNDRAG HCCEEEEEEEECCCC | 41.87 | - | |
69 (in isoform 2) | Ubiquitination | - | 26.13 | - | |
73 | Acetylation | NDRAGVSKGYGFVTF ECCCCCCCCCCEEEE | 54.46 | 20167786 | |
75 | Phosphorylation | RAGVSKGYGFVTFET CCCCCCCCCEEEECC | 15.89 | 18083107 | |
99 | Acetylation | EAEKLNYKDKKLNIG HHHHCCCCCCCCCCC | 63.10 | 20167786 | |
102 | Acetylation | KLNYKDKKLNIGPAI HCCCCCCCCCCCHHH | 57.83 | 88993 | |
111 | Acetylation | NIGPAIRKQQVGIPR CCCHHHHHHHCCCCH | 38.68 | 88997 | |
203 (in isoform 2) | Phosphorylation | - | 17.75 | 25690035 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOLL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOLL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOLL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CA094_HUMAN | C1orf94 | physical | 25416956 | |
HNRLL_HUMAN | HNRNPLL | physical | 25416956 | |
UBA5_HUMAN | UBA5 | physical | 26186194 | |
CD20B_HUMAN | CDC20B | physical | 26186194 | |
ACY1_HUMAN | ACY1 | physical | 26186194 | |
CD20B_HUMAN | CDC20B | physical | 28514442 | |
UBA5_HUMAN | UBA5 | physical | 28514442 | |
ACY1_HUMAN | ACY1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...