RIT1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RIT1_HUMAN
• UniProt AC: Q92963
• Protein Name: GTP-binding protein Rit1
• Gene Name: RIT1
• Organism: Homo sapiens (Human).
• Sequence Length: 219
• Subcellular Localization: Cell membrane.
• Protein Description: Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation. Involved in ELK1 transactivation through the Ras-MAPK signaling cascade that mediates a wide variety of cellular functions, including cell proliferation, survival, and differentiation..
• Protein Sequence: MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	SGTRPVGSCCSSPAG CCCCCCCCCCCCCCC	16.51	27732954
13	Phosphorylation	RPVGSCCSSPAGLSR CCCCCCCCCCCCCCC	43.62	22199227
14	Phosphorylation	PVGSCCSSPAGLSRE CCCCCCCCCCCCCCC	12.59	22199227
19	Phosphorylation	CSSPAGLSREYKLVM CCCCCCCCCCEEEEE	23.34	22964224
22	Phosphorylation	PAGLSREYKLVMLGA CCCCCCCEEEEEECC	14.44	20736484
99	Ubiquitination	AGEGFIICYSITDRR CCCCEEEEEEECCCC	1.54	29967540
103	Ubiquitination	FIICYSITDRRSFHE EEEEEEECCCCCHHH	19.95	29967540
107	Phosphorylation	YSITDRRSFHEVREF EEECCCCCHHHHHHH	31.67	24702127
124	Phosphorylation	LIYRVRRTDDTPVVL HHHHHHCCCCCCEEE	27.88	-
135	Ubiquitination	PVVLVGNKSDLKQLR CEEEECCHHHHHHHH	39.14	29967540
139	Ubiquitination	VGNKSDLKQLRQVTK ECCHHHHHHHHHHCH	52.88	29967540
151	Ubiquitination	VTKEEGLALAREFSC HCHHHHHHHHHHCCC	15.27	29967540
152	Ubiquitination	TKEEGLALAREFSCP CHHHHHHHHHHCCCC	5.77	29967540
156	Ubiquitination	GLALAREFSCPFFET HHHHHHHCCCCCCCC	8.31	29967540
169	Phosphorylation	ETSAAYRYYIDDVFH CCCHHHHHHHHHHHH	7.66	24927040
170	Phosphorylation	TSAAYRYYIDDVFHA CCHHHHHHHHHHHHH	6.73	-
187	Ubiquitination	REIRRKEKEAVLAME HHHHHHHHHHHHHHH	54.75	29967540
204	Ubiquitination	SKPKNSVWKRLKSPF CCCCCCHHHHHCCCC	4.66	29967540
209	Phosphorylation	SVWKRLKSPFRKKKD CHHHHHCCCCCCCCC	33.59	26434776
214	Acetylation	LKSPFRKKKDSVT-- HCCCCCCCCCCCC--	58.52	7495663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RIT1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RIT1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RIT1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNDS_HUMAN	RALGDS	physical	10545207
PTN_HUMAN	PTN	physical	16169070
LRIF1_HUMAN	LRIF1	physical	16169070
AFAD_HUMAN	MLLT4	physical	10545207
RLF_HUMAN	RLF	physical	10545207
MERL_HUMAN	NF2	physical	18332868
KLH12_HUMAN	KLHL12	physical	18303015
LZTR1_HUMAN	LZTR1	physical	28514442
CAMKV_HUMAN	CAMKV	physical	28514442
RIT2_HUMAN	RIT2	physical	28514442
MD2BP_HUMAN	MAD2L1BP	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 615355: Noonan syndrome 8 (NS8)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.