UniProt ID | PTN_HUMAN | |
---|---|---|
UniProt AC | P21246 | |
Protein Name | Pleiotrophin | |
Gene Name | PTN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 168 | |
Subcellular Localization | Secreted . | |
Protein Description | Secreted growth factor that induces neurite outgrowth and which is mitogenic for fibroblasts, epithelial, and endothelial cells. [PubMed: 1768439] | |
Protein Sequence | MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Phosphorylation | PEKKVKKSDCGEWQW CCCCCCHHHCCCEEE | 32.20 | 30631047 | |
53 | Phosphorylation | DCGEWQWSVCVPTSG HCCCEEEEEEEECCC | 7.19 | 30631047 | |
59 | Phosphorylation | WSVCVPTSGDCGLGT EEEEEECCCCCCCCC | 26.94 | 30631047 | |
66 | Phosphorylation | SGDCGLGTREGTRTG CCCCCCCCCCCCCCH | 30.50 | 30631047 | |
101 | Phosphorylation | QFGAECKYQFQAWGE HHCCEEEEEEEECCC | 26.64 | - | |
113 | Phosphorylation | WGECDLNTALKTRTG CCCCCHHHHHHHCCC | 40.44 | - | |
121 | Phosphorylation | ALKTRTGSLKRALHN HHHHCCCHHHHHHHH | 30.06 | 24719451 | |
134 | Phosphorylation | HNAECQKTVTISKPC HHHCCCCEEEEECCC | 9.30 | - | |
153 | Phosphorylation | KPKPQAESKKKKKEG CCCCCHHHHHHHHHC | 53.44 | 22912867 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHD3_HUMAN | CHD3 | physical | 16169070 | |
PTPRZ_HUMAN | PTPRZ1 | physical | 10706604 | |
CTNB1_HUMAN | CTNNB1 | physical | 10706604 | |
GA45G_HUMAN | GADD45G | physical | 15383276 | |
FEZ1_HUMAN | FEZ1 | physical | 15383276 | |
PTN_HUMAN | PTN | physical | 15383276 | |
PIAS4_HUMAN | PIAS4 | physical | 15383276 | |
GASP2_HUMAN | GPRASP2 | physical | 15383276 | |
T22D1_HUMAN | TSC22D1 | physical | 21988832 | |
SGTA_HUMAN | SGTA | physical | 21988832 | |
UBQL1_HUMAN | UBQLN1 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...