| UniProt ID | RIT2_HUMAN | |
|---|---|---|
| UniProt AC | Q99578 | |
| Protein Name | GTP-binding protein Rit2 | |
| Gene Name | RIT2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 217 | |
| Subcellular Localization | Nucleus . Cell membrane . Colocalizes with PLXNB3 at the plasma membrane (PubMed:16122393). | |
| Protein Description | Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator.. | |
| Protein Sequence | MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MEVENEASCSPGSAS CCCCCCCCCCCCCCC | 14.67 | 24043423 | |
| 10 | Phosphorylation | VENEASCSPGSASGG CCCCCCCCCCCCCCC | 29.78 | 24719451 | |
| 13 | Phosphorylation | EASCSPGSASGGSRE CCCCCCCCCCCCCCE | 23.73 | 24043423 | |
| 15 | Phosphorylation | SCSPGSASGGSREYK CCCCCCCCCCCCEEE | 45.44 | 24043423 | |
| 18 | Phosphorylation | PGSASGGSREYKVVM CCCCCCCCCEEEEEE | 26.01 | 24043423 | |
| 22 | Ubiquitination | SGGSREYKVVMLGAG CCCCCEEEEEEECCC | 24.49 | - | |
| 186 | Phosphorylation | REIRKKESMPSLMEK HHHHHHCCCHHHHHH | 44.89 | 25690035 | |
| 208 | Phosphorylation | LWKKLKGSLKKKREN HHHHHHHHHHHHHHH | 35.11 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIT2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIT2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIT2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RAB5A_HUMAN | RAB5A | physical | 11703925 | |
| RLF_HUMAN | RLF | physical | 10545207 | |
| A4_HUMAN | APP | physical | 21832049 | |
| LZTR1_HUMAN | LZTR1 | physical | 26186194 | |
| LZTR1_HUMAN | LZTR1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
