| UniProt ID | UXT_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBK9 | |
| Protein Name | Protein UXT | |
| Gene Name | UXT | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 157 | |
| Subcellular Localization |
Isoform 1: Cytoplasm . Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle pole . Predominantly localizes to the nucleus (PubMed:16221885). Localizes to spindle pole during mito |
|
| Protein Description | Involved in gene transcription regulation. [PubMed: 28106301] | |
| Protein Sequence | MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MATPPKRRAV -----CCCCCCCHHC | 38.53 | 25394399 | |
| 7 | Phosphorylation | -MATPPKRRAVEATG -CCCCCCCHHCHHHH | 37.25 | 23663014 | |
| 7 (in isoform 2) | Phosphorylation | - | 37.25 | 23663014 | |
| 7 | Phosphorylation | -MATPPKRRAVEATG -CCCCCCCHHCHHHH | 37.25 | 23663014 | |
| 15 | Phosphorylation | RAVEATGEKVLRYET HHCHHHHCHHHHHHH | 35.32 | 23663014 | |
| 15 (in isoform 2) | Phosphorylation | - | 35.32 | 23663014 | |
| 15 | Phosphorylation | RAVEATGEKVLRYET HHCHHHHCHHHHHHH | 35.32 | 23663014 | |
| 16 | Ubiquitination | AVEATGEKVLRYETF HCHHHHCHHHHHHHH | 48.16 | 21906983 | |
| 28 | Ubiquitination | ETFISDVLQRDLRKV HHHHHHHHHHHHHHH | 4.08 | 33845483 | |
| 41 | Ubiquitination | KVLDHRDKVYEQLAK HHHHHHHHHHHHHHH | 46.82 | 21906983 | |
| 43 | Phosphorylation | LDHRDKVYEQLAKYL HHHHHHHHHHHHHHH | 12.05 | 28152594 | |
| 48 | Ubiquitination | KVYEQLAKYLQLRNV HHHHHHHHHHHHHHH | 55.90 | 21963094 | |
| 53 | Ubiquitination | LAKYLQLRNVIERLQ HHHHHHHHHHHHHHH | 23.55 | 33845483 | |
| 60 | Ubiquitination | RNVIERLQEAKHSEL HHHHHHHHHHCCCCH | 55.62 | 21963094 | |
| 108 | Ubiquitination | LTLAEALKFIDRKSS HHHHHHHHHHHHCHH | 47.52 | 23000965 | |
| 113 | Ubiquitination | ALKFIDRKSSLLTEL HHHHHHHCHHHHHHH | 40.42 | 23000965 | |
| 115 | Phosphorylation | KFIDRKSSLLTELSN HHHHHCHHHHHHHHH | 30.36 | 21712546 | |
| 120 | Ubiquitination | KSSLLTELSNSLTKD CHHHHHHHHHCCCCC | 5.04 | 23000965 | |
| 125 | Ubiquitination | TELSNSLTKDSMNIK HHHHHCCCCCCHHHH | 32.40 | 23000965 | |
| 126 | Ubiquitination | ELSNSLTKDSMNIKA HHHHCCCCCCHHHHH | 53.77 | 22817900 | |
| 132 | Ubiquitination | TKDSMNIKAHIHMLL CCCCHHHHHHHHHHH | 28.98 | 23503661 | |
| 138 | Ubiquitination | IKAHIHMLLEGLREL HHHHHHHHHHHHHHH | 2.14 | 22817900 | |
| 144 | Ubiquitination | MLLEGLRELQGLQNF HHHHHHHHHHHHHHC | 50.95 | 23503661 | |
| 154 | Ubiquitination | GLQNFPEKPHH---- HHHHCCCCCCC---- | 50.30 | 21906983 | |
| 166 | Ubiquitination | ---------------- ---------------- | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UXT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UXT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UXT_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
