| UniProt ID | WDR92_HUMAN | |
|---|---|---|
| UniProt AC | Q96MX6 | |
| Protein Name | WD repeat-containing protein 92 | |
| Gene Name | WDR92 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 357 | |
| Subcellular Localization | ||
| Protein Description | Seems to act as a modulator of apoptosis.. | |
| Protein Sequence | MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSAFEKPQI ------CCCCCCHHH | 41.48 | 24719451 | |
| 6 | Ubiquitination | --MSAFEKPQIIAHI --CCCCCCHHHEEEE | 35.45 | - | |
| 25 | Ubiquitination | NYTVFDCKWVPCSAK CEEEEECEEEECCCE | 53.74 | - | |
| 32 | Acetylation | KWVPCSAKFVTMGNF EEEECCCEEEECCCC | 24.87 | 26051181 | |
| 32 | Ubiquitination | KWVPCSAKFVTMGNF EEEECCCEEEECCCC | 24.87 | - | |
| 43 | Phosphorylation | MGNFARGTGVIQLYE CCCCCCCCCEEEEEE | 23.79 | - | |
| 49 | Phosphorylation | GTGVIQLYEIQHGDL CCCEEEEEEEECCCH | 8.46 | - | |
| 57 | Acetylation | EIQHGDLKLLREIEK EEECCCHHHHHHHHH | 50.65 | 25953088 | |
| 57 | Ubiquitination | EIQHGDLKLLREIEK EEECCCHHHHHHHHH | 50.65 | - | |
| 64 | Ubiquitination | KLLREIEKAKPIKCG HHHHHHHHCCCCCCC | 68.33 | - | |
| 69 | Ubiquitination | IEKAKPIKCGTFGAT HHHCCCCCCCCCCCC | 34.83 | - | |
| 92 | Ubiquitination | TGDFGGNLHIWNLEA HCCCCCCEEEEECCC | 3.33 | 21906983 | |
| 111 | Ubiquitination | VYSVKGHKEIINAID EEEECCHHHHHHHHC | 60.31 | - | |
| 142 | Ubiquitination | GSRDGTVKVWDPRQK CCCCCCEEECCCCCC | 37.13 | - | |
| 149 | Ubiquitination | KVWDPRQKDDPVANM EECCCCCCCCCCCCC | 66.43 | - | |
| 164 | Ubiquitination | EPVQGENKRDCWTVA CCCCCCCHHHEEEEE | 45.36 | - | |
| 187 | Phosphorylation | ERVVCAGYDNGDIKL CCEEEEEECCCCEEE | 6.42 | 29496907 | |
| 188 | Ubiquitination | RVVCAGYDNGDIKLF CEEEEEECCCCEEEE | 52.28 | 21906983 | |
| 193 | Ubiquitination | GYDNGDIKLFDLRNM EECCCCEEEEEHHHH | 48.09 | - | |
| 209 | Ubiquitination | LRWETNIKNGVCSLE EEEEECCCCCEEEEE | 50.12 | - | |
| 220 | Ubiquitination | CSLEFDRKDISMNKL EEEEECCCCCCHHHE | 62.35 | - | |
| 226 | Ubiquitination | RKDISMNKLVATSLE CCCCCHHHEEEEECC | 35.38 | - | |
| 230 | Phosphorylation | SMNKLVATSLEGKFH CHHHEEEEECCCCEE | 26.77 | 23401153 | |
| 231 | Phosphorylation | MNKLVATSLEGKFHV HHHEEEEECCCCEEE | 18.06 | 21406692 | |
| 235 | Ubiquitination | VATSLEGKFHVFDMR EEEECCCCEEEEECC | 23.95 | - | |
| 235 | Acetylation | VATSLEGKFHVFDMR EEEECCCCEEEEECC | 23.95 | 25953088 | |
| 248 | Ubiquitination | MRTQHPTKGFASVSE CCCCCCCCCEEECCH | 57.38 | - | |
| 256 | Ubiquitination | GFASVSEKAHKSTVW CEEECCHHHHHCCEE | 48.57 | - | |
| 259 | Ubiquitination | SVSEKAHKSTVWQVR ECCHHHHHCCEEEEE | 53.32 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR92_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR92_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR92_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
