UniProt ID | PDRG1_HUMAN | |
---|---|---|
UniProt AC | Q9NUG6 | |
Protein Name | p53 and DNA damage-regulated protein 1 | |
Gene Name | PDRG1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 133 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | May play a role in chaperone-mediated protein folding.. | |
Protein Sequence | MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MLSPEAERVL -----CCCHHHHHHH | 21.28 | 29255136 | |
27 | Ubiquitination | AEEVLADKRQIVDLD HHHHHCCCHHHCCCC | 40.36 | 2190698 | |
36 | Ubiquitination | QIVDLDTKRNQNREG HHCCCCHHCCCCHHH | 49.36 | - | |
52 | Phosphorylation | RALQKDLSLSEDVMV HHHHHHCCCCCCEEH | 39.73 | - | |
54 | Phosphorylation | LQKDLSLSEDVMVCF HHHHCCCCCCEEHHH | 28.51 | - | |
74 | Ubiquitination | KMPHPETKEMIEKDQ CCCCHHHHHHHHHCH | 43.56 | - | |
108 | Ubiquitination | RLFEAQGKPELKGFN HHHHHCCCCCCCCCC | 24.20 | - | |
112 | Ubiquitination | AQGKPELKGFNLNPL HCCCCCCCCCCCCCC | 60.85 | - | |
125 | Ubiquitination | PLNQDELKALKVILK CCCHHHHHHHHHHHC | 50.02 | - | |
128 | Ubiquitination | QDELKALKVILKG-- HHHHHHHHHHHCC-- | 31.89 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDRG1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDRG1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDRG1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PFD2_HUMAN | PFDN2 | physical | 22939629 | |
PFD4_HUMAN | PFDN4 | physical | 22939629 | |
RS3A_HUMAN | RPS3A | physical | 22939629 | |
ACY1_HUMAN | ACY1 | physical | 26344197 | |
RMP_HUMAN | URI1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...