UniProt ID | PFD2_HUMAN | |
---|---|---|
UniProt AC | Q9UHV9 | |
Protein Name | Prefoldin subunit 2 | |
Gene Name | PFDN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization | Nucleus . Cytoplasm . Mitochondrion . | |
Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
Protein Sequence | MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Acetylation | ENSGRAGKSSGSGAG CCCCCCCCCCCCCCC | 40.23 | 18527925 | |
11 | Phosphorylation | NSGRAGKSSGSGAGK CCCCCCCCCCCCCCC | 38.73 | 24719451 | |
12 | Phosphorylation | SGRAGKSSGSGAGKG CCCCCCCCCCCCCCC | 40.23 | 20860994 | |
14 | Phosphorylation | RAGKSSGSGAGKGAV CCCCCCCCCCCCCCC | 27.67 | 28464451 | |
18 | Malonylation | SSGSGAGKGAVSAEQ CCCCCCCCCCCCHHH | 43.07 | 26320211 | |
18 | Ubiquitination | SSGSGAGKGAVSAEQ CCCCCCCCCCCCHHH | 43.07 | 21906983 | |
18 | Acetylation | SSGSGAGKGAVSAEQ CCCCCCCCCCCCHHH | 43.07 | 26051181 | |
22 | Phosphorylation | GAGKGAVSAEQVIAG CCCCCCCCHHHHHHH | 26.08 | 28464451 | |
38 | Methylation | NRLRQEQRGLASKAA HHHHHHHHHHHHHHH | 41.14 | 115487065 | |
43 | Ubiquitination | EQRGLASKAAELEME HHHHHHHHHHHHHHH | 46.11 | 21906983 | |
49 | Sulfoxidation | SKAAELEMELNEHSL HHHHHHHHHHCCCCC | 12.72 | 30846556 | |
73 | Sulfoxidation | ETRKCYRMVGGVLVE HHHHHHHHHCCEEHH | 1.01 | 21406390 | |
84 | Ubiquitination | VLVERTVKEVLPALE EEHHHHHHHHHHHHH | 41.30 | - | |
94 | Ubiquitination | LPALENNKEQIQKII HHHHHCCHHHHHHHH | 63.68 | 21906983 | |
94 | Acetylation | LPALENNKEQIQKII HHHHHCCHHHHHHHH | 63.68 | 26051181 | |
99 | Ubiquitination | NNKEQIQKIIETLTQ CCHHHHHHHHHHHHH | 47.48 | 21906983 | |
111 | Malonylation | LTQQLQAKGKELNEF HHHHHHHCCHHHHHH | 58.52 | 26320211 | |
111 | Ubiquitination | LTQQLQAKGKELNEF HHHHHHHCCHHHHHH | 58.52 | - | |
113 | Acetylation | QQLQAKGKELNEFRE HHHHHCCHHHHHHHH | 59.32 | 26051181 | |
113 | Ubiquitination | QQLQAKGKELNEFRE HHHHHCCHHHHHHHH | 59.32 | - | |
127 | Sulfoxidation | EKHNIRLMGEDEKPA HHHCCCCCCCCCCCC | 3.87 | 28183972 | |
132 | Ubiquitination | RLMGEDEKPAAKENS CCCCCCCCCCCCCCC | 52.88 | 21906983 | |
132 | Acetylation | RLMGEDEKPAAKENS CCCCCCCCCCCCCCC | 52.88 | 23749302 | |
136 | Acetylation | EDEKPAAKENSEGAG CCCCCCCCCCCCCCC | 60.58 | 26051181 | |
136 | Ubiquitination | EDEKPAAKENSEGAG CCCCCCCCCCCCCCC | 60.58 | 21906983 | |
145 | Ubiquitination | NSEGAGAKASSAGVL CCCCCCCCCCCCCCC | 48.13 | 21906983 | |
147 | Phosphorylation | EGAGAKASSAGVLVS CCCCCCCCCCCCCCC | 21.73 | 27251275 | |
148 | Phosphorylation | GAGAKASSAGVLVS- CCCCCCCCCCCCCC- | 33.62 | 27251275 | |
154 | Phosphorylation | SSAGVLVS------- CCCCCCCC------- | 30.28 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...