| UniProt ID | PFD1_HUMAN | |
|---|---|---|
| UniProt AC | O60925 | |
| Protein Name | Prefoldin subunit 1 | |
| Gene Name | PFDN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 122 | |
| Subcellular Localization | ||
| Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
| Protein Sequence | MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAPVDLEL ------CCCCCCHHH | 22.07 | 19413330 | |
| 10 | Acetylation | APVDLELKKAFTELQ CCCCHHHHHHHHHHH | 32.45 | 25953088 | |
| 10 | Ubiquitination | APVDLELKKAFTELQ CCCCHHHHHHHHHHH | 32.45 | 29901268 | |
| 11 | Ubiquitination | PVDLELKKAFTELQA CCCHHHHHHHHHHHH | 62.45 | 27667366 | |
| 19 | Ubiquitination | AFTELQAKVIDTQQK HHHHHHHHHCCCHHH | 27.11 | 23000965 | |
| 26 | Acetylation | KVIDTQQKVKLADIQ HHCCCHHHHHHHHHH | 31.36 | 25953088 | |
| 28 | Methylation | IDTQQKVKLADIQIE CCCHHHHHHHHHHHH | 45.02 | 23644510 | |
| 28 | Ubiquitination | IDTQQKVKLADIQIE CCCHHHHHHHHHHHH | 45.02 | 33845483 | |
| 28 | Malonylation | IDTQQKVKLADIQIE CCCHHHHHHHHHHHH | 45.02 | 26320211 | |
| 28 | Acetylation | IDTQQKVKLADIQIE CCCHHHHHHHHHHHH | 45.02 | 25953088 | |
| 61 | Phosphorylation | LVDETNMYEGVGRMF HHCCCCCCCCCCHHH | 16.17 | 27642862 | |
| 72 | Phosphorylation | GRMFILQSKEAIHSQ CHHHHHHCHHHHHHH | 29.08 | 21712546 | |
| 83 | Ubiquitination | IHSQLLEKQKIAEEK HHHHHHHHHHHHHHH | 57.78 | 29967540 | |
| 97 | Acetylation | KIKELEQKKSYLERS HHHHHHHHHHHHHHH | 34.02 | 25953088 | |
| 99 | Phosphorylation | KELEQKKSYLERSVK HHHHHHHHHHHHHHH | 41.82 | - | |
| 106 | Ubiquitination | SYLERSVKEAEDNIR HHHHHHHHHHHHHHH | 53.07 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |