| UniProt ID | HXD8_HUMAN | |
|---|---|---|
| UniProt AC | P13378 | |
| Protein Name | Homeobox protein Hox-D8 | |
| Gene Name | HOXD8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 290 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
| Protein Sequence | MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | O-linked_Glycosylation | ------MSSYFVNPL ------CCCCCCCHH | 33.47 | 30379171 | |
| 4 | Phosphorylation | ----MSSYFVNPLYS ----CCCCCCCHHHH | 12.30 | 23663014 | |
| 10 | Phosphorylation | SYFVNPLYSKYKAAA CCCCCHHHHHHHHHH | 12.36 | 19835603 | |
| 11 | Phosphorylation | YFVNPLYSKYKAAAA CCCCHHHHHHHHHHH | 36.87 | 19835603 | |
| 13 | Phosphorylation | VNPLYSKYKAAAAAA CCHHHHHHHHHHHHH | 10.42 | 19835603 | |
| 32 | Phosphorylation | EAINPTYYDCHFAPE HHCCCCCCCCCCCCC | 17.99 | 27642862 | |
| 57 | Phosphorylation | ALQLYGNSAAGFPHA HHHHHCCCCCCCCCC | 18.35 | 28348404 | |
| 75 | Phosphorylation | AHAHPHPSPPPSGTG CCCCCCCCCCCCCCC | 47.18 | 28348404 | |
| 139 | Phosphorylation | EPAKFYGYDNLQRQP CCCEECCCCCCCCCC | 7.12 | 27642862 | |
| 179 | Phosphorylation | DPDHLNQSSSPSQMF CCCCCCCCCCHHHCC | 31.54 | 27732954 | |
| 180 | Phosphorylation | PDHLNQSSSPSQMFP CCCCCCCCCHHHCCC | 36.18 | 27732954 | |
| 181 | Phosphorylation | DHLNQSSSPSQMFPW CCCCCCCCHHHCCCC | 33.54 | 27732954 | |
| 183 | Phosphorylation | LNQSSSPSQMFPWMR CCCCCCHHHCCCCCC | 35.90 | 27732954 | |
| 203 | Phosphorylation | GRRRGRQTYSRFQTL CCCCCCCHHCCHHHH | 23.31 | 27174698 | |
| 289 | Phosphorylation | EDRAEGLTN------ HHHHHCCCC------ | 50.14 | 29449344 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXD8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXD8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXD8_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of HXD8_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
