| UniProt ID | AREG_HUMAN | |
|---|---|---|
| UniProt AC | P15514 | |
| Protein Name | Amphiregulin {ECO:0000303|PubMed:2325643} | |
| Gene Name | AREG {ECO:0000312|HGNC:HGNC:651} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 252 | |
| Subcellular Localization |
Membrane Single-pass membrane protein. |
|
| Protein Description | Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.. | |
| Protein Sequence | MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | N-linked_Glycosylation | YAAGLDLNDTYSGKR CEECCCCCCCCCCCC | 38.96 | UniProtKB CARBOHYD | |
| 41 | O-linked_Glycosylation | SGKREPFSGDHSADG CCCCCCCCCCCCCCC | 54.77 | 55824753 | |
| 52 | O-linked_Glycosylation | SADGFEVTSRSEMSS CCCCEEECCHHHCCC | 15.95 | 55824759 | |
| 53 | O-linked_Glycosylation | ADGFEVTSRSEMSSG CCCEEECCHHHCCCC | 38.70 | 55824763 | |
| 109 | Ubiquitination | VRVEQVVKPPQNKTE CEEEEEECCCCCCCC | 52.72 | 21906983 | |
| 113 | N-linked_Glycosylation | QVVKPPQNKTESENT EEECCCCCCCCCCCC | 60.02 | UniProtKB CARBOHYD | |
| 114 | Ubiquitination | VVKPPQNKTESENTS EECCCCCCCCCCCCC | 48.71 | 22817900 | |
| 117 | Phosphorylation | PPQNKTESENTSDKP CCCCCCCCCCCCCCC | 41.18 | - | |
| 119 | N-linked_Glycosylation | QNKTESENTSDKPKR CCCCCCCCCCCCCCH | 54.91 | UniProtKB CARBOHYD | |
| 128 | Ubiquitination | SDKPKRKKKGGKNGK CCCCCHHCCCCCCCC | 61.76 | - | |
| 129 | Ubiquitination | DKPKRKKKGGKNGKN CCCCHHCCCCCCCCC | 75.76 | - | |
| 169 | O-linked_Glycosylation | IEHLEAVTCKCQQEY HHHHEEEECCCCHHH | 17.19 | 55830075 | |
| 184 | Ubiquitination | FGERCGEKSMKTHSM HHHHCCCHHHHHHHH | 40.93 | 23503661 | |
| 187 | Ubiquitination | RCGEKSMKTHSMIDS HCCCHHHHHHHHCHH | 50.61 | 27667366 | |
| 194 | Phosphorylation | KTHSMIDSSLSKIAL HHHHHCHHHHHHHHH | 23.43 | - | |
| 230 | Acetylation | LRRQYVRKYEGEAEE HHHHHHHHHCCCHHH | 37.29 | 7483917 | |
| 230 | Ubiquitination | LRRQYVRKYEGEAEE HHHHHHHHHCCCHHH | 37.29 | 21906983 | |
| 231 | Phosphorylation | RRQYVRKYEGEAEER HHHHHHHHCCCHHHH | 20.71 | 19664994 | |
| 239 | Acetylation | EGEAEERKKLRQENG CCCHHHHHHHHHHHC | 60.48 | 7483925 | |
| 240 | Acetylation | GEAEERKKLRQENGN CCHHHHHHHHHHHCC | 55.94 | 7483933 | |
| 240 | Ubiquitination | GEAEERKKLRQENGN CCHHHHHHHHHHHCC | 55.94 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AREG_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AREG_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AREG_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| ADCY9_HUMAN | ADCY9 | physical | 26186194 | |
| ICAM1_HUMAN | ICAM1 | physical | 26186194 | |
| AREG_HUMAN | AREG | physical | 26186194 | |
| NEUL4_HUMAN | NEURL4 | physical | 26186194 | |
| AREG_HUMAN | AREG | physical | 28514442 | |
| ADCY9_HUMAN | ADCY9 | physical | 28514442 | |
| ICAM1_HUMAN | ICAM1 | physical | 28514442 | |
| SNX11_HUMAN | SNX11 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...