| UniProt ID | VHL_MOUSE | |
|---|---|---|
| UniProt AC | P40338 | |
| Protein Name | von Hippel-Lindau disease tumor suppressor | |
| Gene Name | Vhl | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 181 | |
| Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Nucleus. Colocalizes with ADRB2 at the cell membrane.. |
|
| Protein Description | Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2 (By similarity).. | |
| Protein Sequence | MPRKAASPEEAAGEPGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEEP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MPRKAASPEEAAGE -CCCCCCCHHHHCCC | 37.39 | 26643407 | |
| 34 | Phosphorylation | PVLRSVNSREPSQVI CEECCCCCCCCCEEE | 35.55 | 16847331 | |
| 43 | Glutathionylation | EPSQVIFCNRSPRVV CCCEEEEECCCCCEE | 2.58 | 24333276 | |
| 149 | Phosphorylation | RRLDIVRSLYEDLED HHHHHHHHHHHCHHH | 25.14 | 28059163 | |
| 151 | Phosphorylation | LDIVRSLYEDLEDYP HHHHHHHHHCHHHCH | 14.51 | 28059163 | |
| 168 | Phosphorylation | RKDIQRLSQEHLESQ HHHHHHHHHHHHHHH | 35.39 | 26370283 | |
| 174 | Phosphorylation | LSQEHLESQHLEEEP HHHHHHHHHCCCCCC | 29.29 | 27841257 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 34 | S | Phosphorylation | Kinase | GSK3B | Q9WV60 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VHL_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VHL_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAR6A_MOUSE | Pard6a | physical | 17101696 | |
| PARD3_MOUSE | Pard3 | physical | 17101696 | |
| KPCZ_MOUSE | Prkcz | physical | 17101696 | |
| RBX1_MOUSE | Rbx1 | physical | 23990666 | |
| ELOC_MOUSE | Tceb1 | physical | 23990666 | |
| HIF1A_MOUSE | Hif1a | physical | 17981124 | |
| SUMO1_MOUSE | Sumo1 | physical | 17981124 | |
| EGLN1_MOUSE | Egln1 | physical | 26215701 | |
| RHBT3_MOUSE | Rhobtb3 | physical | 26215701 | |
| AKT1_MOUSE | Akt1 | physical | 27563096 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
