KPCZ_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KPCZ_MOUSE
• UniProt AC: Q02956
• Protein Name: Protein kinase C zeta type
• Gene Name: Prkcz
• Organism: Mus musculus (Mouse).
• Sequence Length: 592
• Subcellular Localization: Cytoplasm . Endosome . Cell junction . In the retina, localizes in the terminals of the rod bipolar cells. Associated with endosomes. Presence of KRIT1, CDH5 and RAP1B is required for its localization to the cell junction. Colocalizes with VAMP2 and
• Protein Description: Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response and maintenance of long-term potentiation (LTP). Upon lipopolysaccharide (LPS) treatment in macrophages, or following mitogenic stimuli, functions downstream of PI3K to activate MAP2K1/MEK1-MAPK1/ERK2 signaling cascade independently of RAF1 activation. Required for insulin-dependent activation of AKT3, but may function as an adapter rather than a direct activator. Upon insulin treatment may act as a downstream effector of PI3K and contribute to the activation of translocation of the glucose transporter SLC2A4/GLUT4 and subsequent glucose transport in adipocytes. In EGF-induced cells, binds and activates MAP2K5/MEK5-MAPK7/ERK5 independently of its kinase activity and can activate JUN promoter through MEF2C. Through binding with SQSTM1/p62, functions in interleukin-1 signaling and activation of NF-kappa-B with the specific adapters RIPK1 and TRAF6. Participates in TNF-dependent transactivation of NF-kappa-B by phosphorylating and activating IKBKB kinase, which in turn leads to the degradation of NF-kappa-B inhibitors. In migrating astrocytes, forms a cytoplasmic complex with PARD6A and is recruited by CDC42 to function in the establishment of cell polarity along with the microtubule motor and dynein. In association with FEZ1, stimulates neuronal differentiation in PC12 cells. In the inflammatory response, is required for the T-helper 2 (Th2) differentiation process, including interleukin production, efficient activation of JAK1 and the subsequent phosphorylation and nuclear translocation of STAT6. May be involved in development of allergic airway inflammation (asthma), a process dependent on Th2 immune response. In the NF-kappa-B-mediated inflammatory response, can relieve SETD6-dependent repression of NF-kappa-B target genes by phosphorylating the RELA subunit at 'Ser-311'. Necessary and sufficient for LTP maintenance in hippocampal CA1 pyramidal cells. In vein endothelial cells treated with the oxidant peroxynitrite, phosphorylates STK11 leading to nuclear export of STK11, subsequent inhibition of PI3K/Akt signaling, and increased apoptosis. Phosphorylates VAMP2 in vitro (By similarity)..
• Protein Sequence: MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MPSRTDPKMDRS ---CCCCCCCCCCCC	62.08	20139300
113	Phosphorylation	PCPGEDKSIYRRGAR CCCCCCCCHHHHHHH	36.85	22817900
155	Phosphorylation	SERIWGLSRQGYRCI HHHHHCCCCCCEEEE	20.72	22006019
160	Methylation	GLSRQGYRCINCKLL CCCCCCEEEECCEEE	22.97	16289167
186	Phosphorylation	TCRRHMDSVMPSQEP CHHHHHHHCCCCCCC	16.85	22817900
217	Phosphorylation	DGIAYISSSRKHDNI CCEEEEECCCCCCCC	25.30	22817900
218	Phosphorylation	GIAYISSSRKHDNIK CEEEEECCCCCCCCC	38.26	22817900
262	Phosphorylation	IRVIGRGSYAKVLLV EEEECCCCCEEEEEE	22.13	25338131
263	Phosphorylation	RVIGRGSYAKVLLVR EEECCCCCEEEEEEE	17.17	29514104
375	Methylation	HERGIIYRDLKLDNV HHCCCCCCCCCCCCE	32.17	30988871
407	Phosphorylation	EGLGPGDTTSTFCGT CCCCCCCCCCCCCCC	28.67	20469934
408	Phosphorylation	GLGPGDTTSTFCGTP CCCCCCCCCCCCCCC	30.43	21183079
409	Phosphorylation	LGPGDTTSTFCGTPN CCCCCCCCCCCCCCC	22.91	22322096
410	O-linked_Glycosylation	GPGDTTSTFCGTPNY CCCCCCCCCCCCCCE	22.35	29249667
410	Phosphorylation	GPGDTTSTFCGTPNY CCCCCCCCCCCCCCE	22.35	25521595
414	Phosphorylation	TTSTFCGTPNYIAPE CCCCCCCCCCEECHH	15.00	19060867
417	Phosphorylation	TFCGTPNYIAPEILR CCCCCCCEECHHHHC	10.32	20469934
513	Acetylation	QTGFSDIKSHAFFRS CCCCCHHHHHHHHHH	40.97	7617797
520	Phosphorylation	KSHAFFRSIDWDLLE HHHHHHHHCCHHHHH	21.53	22817900
560	Phosphorylation	TSEPVQLTPDDEDVI CCCCCCCCCCCHHHH	13.95	22817900
573	Phosphorylation	VIKRIDQSEFEGFEY HHHHCCHHHCCCCCC	40.27	21743459
580	Phosphorylation	SEFEGFEYINPLLLS HHCCCCCCCCHHHHH	12.07	21743459
587	Phosphorylation	YINPLLLSAEESV-- CCCHHHHHHHHCC--	33.34	21743459
591	Phosphorylation	LLLSAEESV------ HHHHHHHCC------	25.32	21743459

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
113	S	Phosphorylation	Kinase	PRKCZ	Q05513	GPS
186	S	Phosphorylation	Kinase	PRKCZ	Q05513	GPS
410	T	Phosphorylation	Kinase	PDPK1	Q9Z2A0	Uniprot
410	T	Phosphorylation	Kinase	PI3K	-	Uniprot
560	T	Phosphorylation	Kinase	PRKCZ	Q05513	GPS
560	T	Phosphorylation	Kinase	PKCZ	Q02956	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
410	T	Phosphorylation	CDH5 is required for its phosphorylation at Thr-410.	-
410	T	Phosphorylation	Phosphorylation at Thr-410 by PI3K activates the kinase (By similarity).	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KPCZ_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GSK3B_MOUSE	Gsk3b	physical	17053159
MBP_MOUSE	Mbp	physical	14685273
PAR6A_MOUSE	Pard6a	physical	14685273
KPYM_MOUSE	Pkm	physical	14685273
KPCZ_RAT	Prkcz	physical	8694767
PAR6A_MOUSE	Pard6a	physical	16510873
PARD3_MOUSE	Pard3	physical	16510873
GSK3B_MOUSE	Gsk3b	physical	16510873
DYST_HUMAN	DST	physical	26496610
IFIT1_HUMAN	IFIT1	physical	26496610
LASP1_HUMAN	LASP1	physical	26496610
STX3_HUMAN	STX3	physical	26496610
SF01_HUMAN	SF1	physical	26496610
MRCKB_HUMAN	CDC42BPB	physical	26496610
ACTZ_HUMAN	ACTR1A	physical	26496610
RBP1_HUMAN	RALBP1	physical	26496610
RPC1_HUMAN	POLR3A	physical	26496610
PDS5B_HUMAN	PDS5B	physical	26496610
GOLI4_HUMAN	GOLIM4	physical	26496610
CTF8_HUMAN	CHTF8	physical	26496610
ATG3_HUMAN	ATG3	physical	26496610
ASPM_HUMAN	ASPM	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.