| UniProt ID | SIS1_YEAST | |
|---|---|---|
| UniProt AC | P25294 | |
| Protein Name | Protein SIS1 | |
| Gene Name | SIS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 352 | |
| Subcellular Localization | Cytoplasm . Nucleus . Localized throughout the cell but is more concentrated at the nucleus. | |
| Protein Description | Required for nuclear migration during mitosis. It is required for the normal initiation of translation. Might mediate the dissociation of a specific protein complex of the translation machinery. Essential for viability.. | |
| Protein Sequence | MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFGGSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGGFRSASSSPTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Acetylation | --MVKETKLYDLLGV --CCCCCCHHHHHCC | 46.25 | 24489116 | |
| 6 | Ubiquitination | --MVKETKLYDLLGV --CCCCCCHHHHHCC | 46.25 | 17644757 | |
| 14 | Phosphorylation | LYDLLGVSPSANEQE HHHHHCCCCCCCHHH | 16.02 | 22369663 | |
| 16 | Phosphorylation | DLLGVSPSANEQELK HHHCCCCCCCHHHHH | 35.90 | 22369663 | |
| 23 | Acetylation | SANEQELKKGYRKAA CCCHHHHHHHHHHHH | 43.32 | 24489116 | |
| 23 | Ubiquitination | SANEQELKKGYRKAA CCCHHHHHHHHHHHH | 43.32 | 17644757 | |
| 24 | Ubiquitination | ANEQELKKGYRKAAL CCHHHHHHHHHHHHH | 74.03 | 17644757 | |
| 32 | Acetylation | GYRKAALKYHPDKPT HHHHHHHHHCCCCCC | 36.47 | 22865919 | |
| 37 | Acetylation | ALKYHPDKPTGDTEK HHHHCCCCCCCCHHH | 49.26 | 22865919 | |
| 44 | Acetylation | KPTGDTEKFKEISEA CCCCCHHHHHHHHHH | 64.92 | 22865919 | |
| 46 | Acetylation | TGDTEKFKEISEAFE CCCHHHHHHHHHHHH | 66.27 | 24489116 | |
| 60 | Acetylation | EILNDPQKREIYDQY HHHCCHHHHHHHHHH | 58.34 | 24489116 | |
| 169 | Phosphorylation | GMPGGFRSASSSPTY CCCCCCCCCCCCCCC | 30.18 | 22369663 | |
| 171 | Phosphorylation | PGGFRSASSSPTYPE CCCCCCCCCCCCCCC | 32.37 | 22369663 | |
| 172 | Phosphorylation | GGFRSASSSPTYPEE CCCCCCCCCCCCCCC | 39.80 | 22369663 | |
| 173 | Phosphorylation | GFRSASSSPTYPEEE CCCCCCCCCCCCCCC | 20.83 | 22369663 | |
| 175 | Phosphorylation | RSASSSPTYPEEETV CCCCCCCCCCCCCEE | 54.37 | 22369663 | |
| 176 | Phosphorylation | SASSSPTYPEEETVQ CCCCCCCCCCCCEEE | 16.42 | 22369663 | |
| 181 | Phosphorylation | PTYPEEETVQVNLPV CCCCCCCEEEEECCC | 21.37 | 22369663 | |
| 189 | Phosphorylation | VQVNLPVSLEDLFVG EEEECCCCHHHHCCC | 24.89 | 22369663 | |
| 222 | Acetylation | TQIDIQLKPGWKAGT CEEEEEECCCCCCCC | 25.72 | 24489116 | |
| 243 | Phosphorylation | QGDYNPQTGRRKTLQ CCCCCCCCCCEEEEE | 33.63 | 28889911 | |
| 248 | Phosphorylation | PQTGRRKTLQFVIQE CCCCCEEEEEEEEEC | 24.79 | 28889911 | |
| 256 | Acetylation | LQFVIQEKSHPNFKR EEEEEECCCCCCCCC | 37.37 | 24489116 | |
| 271 | Phosphorylation | DGDDLIYTLPLSFKE CCCCEEEECCCCHHH | 18.20 | 24961812 | |
| 275 | Phosphorylation | LIYTLPLSFKESLLG EEEECCCCHHHHHHC | 32.12 | 25521595 | |
| 284 | Phosphorylation | KESLLGFSKTIQTID HHHHHCCCCEEEEEC | 27.39 | 21440633 | |
| 294 | Phosphorylation | IQTIDGRTLPLSRVQ EEEECCCEEECCCEE | 37.95 | 21440633 | |
| 306 | Phosphorylation | RVQPVQPSQTSTYPG CEECCCCCCCCCCCC | 29.06 | 29136822 | |
| 308 | Phosphorylation | QPVQPSQTSTYPGQG ECCCCCCCCCCCCCC | 27.63 | 29136822 | |
| 309 | Phosphorylation | PVQPSQTSTYPGQGM CCCCCCCCCCCCCCC | 20.50 | 29136822 | |
| 310 | Phosphorylation | VQPSQTSTYPGQGMP CCCCCCCCCCCCCCC | 36.80 | 29136822 | |
| 311 | Phosphorylation | QPSQTSTYPGQGMPT CCCCCCCCCCCCCCC | 12.72 | 29136822 | |
| 318 | Phosphorylation | YPGQGMPTPKNPSQR CCCCCCCCCCCHHHC | 37.69 | 23749301 | |
| 320 | Ubiquitination | GQGMPTPKNPSQRGN CCCCCCCCCHHHCCC | 81.57 | 23749301 | |
| 331 | Acetylation | QRGNLIVKYKVDYPI HCCCEEEEEEEECCC | 32.15 | 24489116 | |
| 333 | Acetylation | GNLIVKYKVDYPISL CCEEEEEEEECCCCC | 23.94 | 24489116 | |
| 333 | Succinylation | GNLIVKYKVDYPISL CCEEEEEEEECCCCC | 23.94 | 23954790 | |
| 339 | Phosphorylation | YKVDYPISLNDAQKR EEEECCCCCCHHHHH | 19.33 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIS1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIS1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-14 AND SER-173, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-173, AND MASSSPECTROMETRY. | |