dbPTM

CUR1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CUR1_YEAST
UniProt AC	Q06469
Protein Name	Curing of [URE3] protein 1
Gene Name	CUR1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	252
Subcellular Localization	Nucleus .
Protein Description	Involved in the curing of prion [URE3]. Nuclear localization of this protein may suggest a role in transcription regulation, so it might exert an effect on [URE3] through known prion-curing chaperones or BTN2..
Protein Sequence	MAAACICQPNLLEINVSDGPLDMIRKKRKIQQPQLRPPLRENKCQPHFSVRKVNQSYIISLHKEITCQLIAEIVKQKLSRIWEKVYIPSYELISDKDGNQIYVEQSVDENRLTSEIMEKLDPNNIDIEAIEILFDDYHLELSRLTNGIIISSANDHFYREFSFNNIIDDNFKICGTSMSADSFDKIYGVMWIEVPFNGNGLQNDSAVNRVSTSHNQIEELNDIEQEIRAFNISRSNQESIIKKEVSRRLNGR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	NKCQPHFSVRKVNQS CCCCCCCEEEEECHH	20.27	28889911
89	Phosphorylation	WEKVYIPSYELISDK HHHEEECCEEEEECC	22.98	19779198
90	Phosphorylation	EKVYIPSYELISDKD HHEEECCEEEEECCC	14.92	19779198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CUR1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CUR1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CUR1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIS1_YEAST	SIS1	physical	18719252
SIS1_YEAST	SIS1	physical	22718905
RPB7_YEAST	RPB7	genetic	27708008
NU192_YEAST	NUP192	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
MCM1_YEAST	MCM1	genetic	27708008
ROT1_YEAST	ROT1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CUR1_YEAST

Related Literatures of Post-Translational Modification