UniProt ID | CUR1_YEAST | |
---|---|---|
UniProt AC | Q06469 | |
Protein Name | Curing of [URE3] protein 1 | |
Gene Name | CUR1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 252 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in the curing of prion [URE3]. Nuclear localization of this protein may suggest a role in transcription regulation, so it might exert an effect on [URE3] through known prion-curing chaperones or BTN2.. | |
Protein Sequence | MAAACICQPNLLEINVSDGPLDMIRKKRKIQQPQLRPPLRENKCQPHFSVRKVNQSYIISLHKEITCQLIAEIVKQKLSRIWEKVYIPSYELISDKDGNQIYVEQSVDENRLTSEIMEKLDPNNIDIEAIEILFDDYHLELSRLTNGIIISSANDHFYREFSFNNIIDDNFKICGTSMSADSFDKIYGVMWIEVPFNGNGLQNDSAVNRVSTSHNQIEELNDIEQEIRAFNISRSNQESIIKKEVSRRLNGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | NKCQPHFSVRKVNQS CCCCCCCEEEEECHH | 20.27 | 28889911 | |
89 | Phosphorylation | WEKVYIPSYELISDK HHHEEECCEEEEECC | 22.98 | 19779198 | |
90 | Phosphorylation | EKVYIPSYELISDKD HHEEECCEEEEECCC | 14.92 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CUR1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CUR1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CUR1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SIS1_YEAST | SIS1 | physical | 18719252 | |
SIS1_YEAST | SIS1 | physical | 22718905 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
NU192_YEAST | NUP192 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
ROT1_YEAST | ROT1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...