MCM1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MCM1_YEAST
• UniProt AC: P11746
• Protein Name: Pheromone receptor transcription factor
• Gene Name: MCM1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 286
• Subcellular Localization: Nucleus.
• Protein Description: Transcription factor required for the efficient replication of minichromosomes and the transcriptional regulation of early cell cycle genes. Activates transcription of ECB-dependent genes during the G1/M phase. Genes that contain a ECB (early cell box) element in their transcription regulatory region are transcribed only during G1/M phases. Interacts with the alpha-2 repressor or with the alpha-1 activator thereby regulating the expression of mating-type-specific genes. With ARG80, ARG81 and ARG82, coordinates the expression of arginine anabolic and catabolic genes in response to arginine..
• Protein Sequence: MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGNDMQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQQQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQQQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDIEEGTP ------CCCCCCCCC	47.50	22814378
2	Phosphorylation	------MSDIEEGTP ------CCCCCCCCC	47.50	22369663
8	Phosphorylation	MSDIEEGTPTNNGQQ CCCCCCCCCCCCCCC	30.16	22369663
10	Phosphorylation	DIEEGTPTNNGQQKE CCCCCCCCCCCCCCC	40.95	22369663
35	Phosphorylation	NKTRRHVTFSKRKHG CCCCCCEEECHHHCC	18.96	21177495
82	Phosphorylation	PKFEPIVTQQEGRNL CCCCCCCCHHHHHHH	25.84	27214570
144	Phosphorylation	VLNAHANSLGHLNQD HHHHHHHHHHCCCCC	36.19	23810556

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MCM1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MCM1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MCM1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCM7_YEAST	MCM7	physical	12738768
FKH2_YEAST	FKH2	physical	10959837
FKH2_YEAST	FKH2	physical	10899128
FKH2_YEAST	FKH2	physical	10894549
STE12_YEAST	STE12	physical	1756728
MTAL1_YEAST	HMLALPHA1	physical	8139556
HMAL1_YEAST	HMLALPHA1	physical	8139556
STE12_YEAST	STE12	physical	8139556
ARGR1_YEAST	ARG80	physical	10632874
ARGR2_YEAST	ARG81	physical	10632874
IPMK_YEAST	ARG82	physical	10632874
MCM1_YEAST	MCM1	physical	10632874
YOX1_YEAST	YOX1	physical	12464633
YHP1_YEAST	YHP1	physical	12464633
MTAL2_YEAST	HMLALPHA2	physical	9490409
HMAL2_YEAST	HMLALPHA2	physical	9490409
PGM1_YEAST	PGM1	genetic	7623855
H4_YEAST	HHF1	physical	16554755
BOP3_YEAST	BOP3	physical	16554755
SNF5_YEAST	SNF5	physical	19233144
SNF6_YEAST	SNF6	physical	19233144
NDD1_YEAST	NDD1	genetic	10207056
YOX1_YEAST	YOX1	physical	20385087
FKH2_YEAST	FKH2	physical	20385087
MCM7_YEAST	MCM7	genetic	12738768

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2; THR-8 AND SER-144,AND MASS SPECTROMETRY.
PubMed: 18407956