MTAL1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MTAL1_YEAST
• UniProt AC: P0CY06
• Protein Name: Mating-type protein ALPHA1
• Gene Name: MATALPHA1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 175
• Subcellular Localization: Nucleus .
• Protein Description: Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional coactivator that, in alpha-cells, binds cooperatively with MCM1 and STE12 to a DNA sequence termed the QP' element, to activate the transcription of alpha-specific genes..
• Protein Sequence: MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MTAL1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MTAL1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MTAL1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MTAL1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTAL2_YEAST	HMLALPHA2	physical	7569974
HMAL2_YEAST	HMLALPHA2	physical	7569974
DIG1_YEAST	DIG1	physical	18719252
DIG2_YEAST	DIG2	physical	18719252
STE12_YEAST	STE12	physical	18719252

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.