| UniProt ID | HMAL2_YEAST | |
|---|---|---|
| UniProt AC | P0CY09 | |
| Protein Name | Silenced mating-type protein ALPHA2 | |
| Gene Name | HMLALPHA2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 210 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Silenced copy of ALPHA2 at HML.. | |
| Protein Sequence | MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNKIPIKD -------CCCCCHHH | 11.84 | - | |
| 3 | Ubiquitination | -----MNKIPIKDLL -----CCCCCHHHHC | 48.86 | 17644757 | |
| 7 | Ubiquitination | -MNKIPIKDLLNPQI -CCCCCHHHHCCHHH | 36.65 | 17644757 | |
| 19 | Ubiquitination | PQITDEFKSSILDIN HHHCHHHHHHHHHHH | 41.04 | 17644757 | |
| 109 | Ubiquitination | YQLTQKNKSADGLVF CCCCCCCCCCCCCEE | 54.80 | 17644757 | |
| 126 | Ubiquitination | VTQDMINKSTKPYRG ECHHHHCCCCCCCCC | 48.88 | 17644757 | |
| 188 | Ubiquitination | SNRRRKEKTITIAPE HCCCCCCCEEEECHH | 48.54 | 17644757 | |
| 207 | Ubiquitination | LSGEPLAKKKE---- HCCCCCCCCCC---- | 72.55 | 17644757 | |
| 208 | Ubiquitination | SGEPLAKKKE----- CCCCCCCCCC----- | 57.43 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMAL2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMAL2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMAL2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CYC8_YEAST | CYC8 | physical | 10759558 | |
| TUP1_YEAST | TUP1 | physical | 9315661 | |
| HMRA1_YEAST | HMRA1 | physical | 7569974 | |
| ASG7_YEAST | ASG7 | genetic | 13680367 | |
| SST2_YEAST | SST2 | genetic | 13680367 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
