UniProt ID | HMRA1_YEAST | |
---|---|---|
UniProt AC | P0CY11 | |
Protein Name | Silenced mating-type protein A1 | |
Gene Name | HMRA1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 126 | |
Subcellular Localization | Nucleus. | |
Protein Description | Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Silenced copy of A1 at HMR.. | |
Protein Sequence | MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLEIYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of HMRA1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMRA1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMRA1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMRA1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APC11_YEAST | APC11 | genetic | 27708008 | |
RIB2_YEAST | RIB2 | genetic | 27708008 | |
ENP1_YEAST | ENP1 | genetic | 27708008 | |
TCPD_YEAST | CCT4 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
COG3_YEAST | COG3 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
TAF6_YEAST | TAF6 | genetic | 27708008 | |
CDC20_YEAST | CDC20 | genetic | 27708008 | |
GPI10_YEAST | GPI10 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
FDFT_YEAST | ERG9 | genetic | 27708008 | |
EI2BB_YEAST | GCD7 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
HRP1_YEAST | HRP1 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...